Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Species
Human papillomavirus type 16
Expression Region
1-158aa
Target Protein Sequence
MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human Papillomavirus (HPV) 16 Protein E6 produced in E.Coli (identified by the LC-MS/MS Analysis) contains 158 amino acids covering the full length of HPV-16. And it has its N-terminus fused with a 6xHis tag and a total molecular weight of 23.2 kDa. The purity of this HPV-16 E6 protein is greater than 90% as measured by SDS-PAGE. In stock of this protein means there is no waiting period for protein preparation. Importantly, this recombinant HPV-16 E6 protein can be used in the studies of epigenetics and neuclear signaling research area.
HPV type 16 is one of the most prevalent high-risk HPVs causally related to anogenital malignancies as well as head &neck tumors. Its encoding intracellular oncoprotein E6 is implicated in the immortalization and maligant transformation of HPV-infected cells. HPV -16 E6 exerts these functions by facilitating telomerase activity and targeting p53 tumour suppressor for rapid proteasome-mediated degradation via E6/E6AP complexes.