Recombinant Human Delta-like protein 3 (DLL3), partial

In Stock
Code CSB-EP882142HU
Abbreviation Recombinant Human DLL3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Delta Drosophila like 3; Delta like 3 Drosophila; Delta like 3 homolog Drosophila; Delta like 3 protein; Delta like protein 3 precursor; Delta-like protein 3; Delta3; Dll3; DLL3_HUMAN; Drosophila Delta homolog 3; SCDO1; SCOD1; Spondylocostal dysostosis autosomal recessive
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-492aa
Target Protein Sequence
AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.5kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This is a recombinant fragment of human Delta‑like protein 3 (DLL3) expressed in E.coli with an N‑terminal 6xHis-SUMO tag and purified to >90% by SDS‑PAGE. It has a molecular weight of ~64.5kDa and is supplied as liquid or lyophilized powder for cell‑biology applications.

DLL3 (Delta-like protein 3) is an important regulator of the Notch signaling pathway and belongs to the DSL (Delta/Serrate/LAG-2) family. This product contains amino acids 27-492, covering the major extracellular functional domains of DLL3.


Potential Applications

Note: The following applications are based on the known biological functions of DLL3 protein and scientific literature predictions. Our company has not validated all listed applications, and specific effects need to be verified by customers according to their experimental requirements. We recommend conducting small-scale preliminary experiments before formal studies.

1. Cancer Biology Research

Application:
Used to study how DLL3 functions in small cell lung cancer (SCLC) and neuroendocrine tumors. DLL3 expression in cancer cell lines can be measured using Western blot or ELISA. A standard curve can be used to analyze DLL3 levels in tumor tissues. It can also serve as a positive control in immunofluorescence staining to test antibody specificity.

Scientific Basis:
DLL3 is highly expressed in about 85% of SCLC cases. It is a key target of the ADC drug Rovalpituzumab tesirine.


2. Notch Signaling Pathway Studies

Application:
DLL3 can be used to study how it blocks the Notch pathway, as it is an atypical Notch ligand. Co-culture experiments can test how DLL3 affects Notch activation in nearby cells. Luciferase reporter assays can measure the activity of downstream transcription factors (HES1, HEY1). Co-immunoprecipitation can confirm specific binding between DLL3 and Notch receptors.

Scientific Basis:
DLL3 works through a "cis-inhibition" mechanism that blocks Notch signaling, which is opposite to how DLL1 and DLL4 function.


3. Antibody Development and Testing

Application:
Used as a standard antigen to support the development and testing of anti-DLL3 antibodies. It can be used for monoclonal antibody screening and affinity optimization. SPR can measure antibody binding kinetics. ELISA methods can be developed and validated for linear range, detection limit, and precision. Competitive binding assays can help identify antibody binding sites.

Scientific Basis:
The extracellular domain of the recombinant DLL3 protein (amino acids 27–492) contains key antibody epitopes, making it suitable for antibody development and analysis.


4. Studying Cell Surface Receptor Interactions

Application:
Used to study how DLL3 binds to cell surface receptors and interacts with other surface molecules. Since DLL3 is mostly found inside normal cells, these studies should use tumor cells or engineered cells that express DLL3 on the surface. Flow cytometry can test binding ability. Fluorescent labeling can help analyze binding kinetics. Cross-linking mass spectrometry can identify possible binding partners. DLL3-based cell sorting methods can also be developed.

Scientific Basis:
DLL3’s extracellular domain contains multiple functional regions that can bind specifically to other surface proteins.


5. Drug Screening and Development

Application:
Acts as a target protein for screening drugs that affect DLL3 activity. A high-throughput screening system based on DLL3–Notch interaction can be built. Small molecule inhibitors can be tested for IC50 values and structure–activity relationships. Protein–protein interaction platforms can be developed using AlphaLISA. DLL3 can also be used to test the activity of ADC drugs in vitro.

Scientific Basis:
DLL3 is an important target for cancer therapy. Several related drugs are in clinical trials.


6. Protein Structure and Function Studies

Application:
Used to study the molecular structure and function of DLL3. The 3D structure of the extracellular domain can be analyzed using X-ray crystallography. NMR can reveal structural dynamics. Cryo-electron microscopy (cryo-EM) can show how DLL3 binds to receptors. Molecular docking and dynamics simulations can help explore binding mechanisms.

Scientific Basis:
This recombinant protein includes the full extracellular domain and keeps the key structural features of the natural protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you please help me to answer a question about the Recombinant Human Delta-like protein 3(DLL3), product code CSB-EP882142HU?
-Do you have functional data regarding this protein?
-Could you please provide the 6xHis-SUMO tag sequence?

A:
Thanks for your inquiry. Here are answers to your questoin.
1) We didn't do experiment about the functional data of this protein. It has been ordered many times, but no customer sent back data or feedback.
2) The sequence of N-terminal 6xHis-SUMO tag is shown in the section of specification in details.
Q:

I would like to ask if you have any huDLL3 conjugated to a human Fc for a bulk order of (~2 mg)

A:
Thanks for your inquiry. Recombinant Human Delta-like protein 3(DLL3)
CSB-YP882142HU >> Yeast Available Size: 10ug 50ug 100ug 200ug 500ug 1mg 2mg
CSB-EP882142HU >> E. coli Available Size: 10ug 50ug 100ug 200ug 500ug 1mg 2mg
CSB-BP882142HU >> Baculovirus Available Size: 50ug 100ug 500ug 1mg 2mg
CSB-MP882142HU >> Mammalian cell Available Size: 50ug 100ug 500ug 1mg 2mg
Q:

We have some inquiries about your product, DLL3 Recombinant Protein, Cat# CSB-EP882142HU.
Does this product contain a carrier protein?

A:
Very nice to receive your inquiry. Code: CSB-EP882142HU
Name: Recombinant Human Delta-like protein 3(DLL3),partial
Size: 50ug
Lead Time: We have inventory for this protein. If it can pass quality control, then the lead time will be 5-7 working days. If it can't pass QC, then the lead time will be 15-20 working days.
Expression Region: 27-492aa, Extracellular Domain
Tag Info: N-terminal 6xHis-SUMO-tag
Target Protein Sequence:

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCAC
APGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL


This is a 6xHis-SUMO-tagged protein. The quality control purity is higher than 90%. It may contain very small amount of non-target protein.

Target Background

Function
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Gene References into Functions
  1. these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
  2. Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
  3. our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
  4. The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
  5. Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
  6. DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
  7. We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
  8. mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
  9. no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
  10. The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Show More

Hide All

Involvement in disease
Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*