Name: Recombinant Human Delta-like protein 3(DLL3),partial
Brand: CUSABIO
SKU: CSB-EP882142HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

DLL3

Uniprot No.

Q9NYJ7

Research Area

Developmental Biology

Alternative Names

Delta Drosophila like 3; Delta like 3 Drosophila; Delta like 3 homolog Drosophila; Delta like 3 protein; Delta like protein 3 precursor; Delta-like protein 3; Delta3; Dll3; DLL3_HUMAN; Drosophila Delta homolog 3; SCDO1; SCOD1; Spondylocostal dysostosis autosomal recessive

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

27-492aa

Target Protein Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

64.5kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting
and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Could you please help me to answer a question about the Recombinant Human Delta-like protein 3(DLL3), product code CSB-EP882142HU?
-Do you have functional data regarding this protein?
-Could you please provide the 6xHis-SUMO tag sequence?

Thanks for your inquiry. Here are answers to your questoin.
1) We didn't do experiment about the functional data of this protein. It has been ordered many times, but no customer sent back data or feedback.
2) The sequence of N-terminal 6xHis-SUMO tag is shown in the section of specification in details.

I would like to ask if you have any huDLL3 conjugated to a human Fc for a bulk order of (~2 mg)

Thanks for your inquiry. Recombinant Human Delta-like protein 3(DLL3)
CSB-YP882142HU >> Yeast Available Size: 10ug 50ug 100ug 200ug 500ug 1mg 2mg
CSB-EP882142HU >> E. coli Available Size: 10ug 50ug 100ug 200ug 500ug 1mg 2mg
CSB-BP882142HU >> Baculovirus Available Size: 50ug 100ug 500ug 1mg 2mg
CSB-MP882142HU >> Mammalian cell Available Size: 50ug 100ug 500ug 1mg 2mg

We have some inquiries about your product, DLL3 Recombinant Protein, Cat# CSB-EP882142HU.
Does this product contain a carrier protein?

Very nice to receive your inquiry. Code: CSB-EP882142HU
Name: Recombinant Human Delta-like protein 3(DLL3),partial
Size: 50ug
Lead Time: We have inventory for this protein. If it can pass quality control, then the lead time will be 5-7 working days. If it can't pass QC, then the lead time will be 15-20 working days.
Expression Region: 27-492aa, Extracellular Domain
Tag Info: N-terminal 6xHis-SUMO-tag
Target Protein Sequence:

This is a 6xHis-SUMO-tagged protein. The quality control purity is higher than 90%. It may contain very small amount of non-target protein.

Target Background

Function

Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.

Gene References into Functions

these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Hide All

Involvement in disease

Spondylocostal dysostosis 1, autosomal recessive (SCDO1)

Subcellular Location

Membrane; Single-pass type I membrane protein.

Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP882142HU
Size	$224
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Delta-like protein 3(DLL3),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage