Recombinant Mouse Granulocyte-macrophage colony-stimulating factor(Csf2) (Active)

In Stock
Code CSB-AP003651MO
Product Type Colony Stimulating Factor
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01587
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Alias Granulocyte-Macrophage Colony-Stimulating Factor; GM-CSF; Colony-Stimulating Factor; CSF;Molgramostin; Sargramostim; CSF2; GMCSF
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using PDC-P1 cells is less than 100 pg/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Research Area Immunology
Source Mammalian cell
Gene Names Csf2
Expression Region 18-141aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 15.1 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Subcellular Location Secreted
Protein Families GM-CSF family
Database Links

KEGG: mmu:12981

STRING: 10090.ENSMUSP00000019060

UniGene: Mm.4922

Pathway Jak-STAT signaling pathway
TNF signaling pathway
Fc epsilon RI signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway

Related Products

Csf2 Antibodies

Csf2 Antibodies for Mus musculus (Mouse)

Csf2 Proteins

Csf2 Proteins for Mus musculus (Mouse)

Csf2 ELISA Kit

Csf2 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.