Recombinant Dog Interleukin-13 (IL13) (Active)

In Stock
Code CSB-MP868226DO
Abbreviation Recombinant Dog IL13 protein (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 3.930-20.07 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 3.930-20.07 ng/mL.
Target Names
Uniprot No.
Alternative Names
Interleukin-13; IL-13
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
Mammalian cell
Expression Region
19-131aa
Target Protein Sequence
SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR
Mol. Weight
14.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant dog IL13 protein is derived from the mammalian cell expression system. The target gene encodes the 19-131aa of the dog IL13. It is labeled with Ca -terminal 10xHis-tag. It has been validated to be biologically active in a proliferation assay as it stimulates the proliferation of TF-1 cells in a dose-dependent manner, with the ED50 of 3.930-20.07 ng/mL. Its purity exceeds 95% as determined by SDS-PAGE, and its endotoxin level is less than 1.0 EU/ug as measured by the LAL method.

The IL13 protein in dogs plays a significant role in modulating immune responses and inflammation, similar to its functions in other species. IL13 is primarily produced by T-helper type 2 (Th2) cells, but it can also be secreted by various other immune cells such as mast cells, basophils, and eosinophils [1]. This cytokine is crucial in regulating allergic responses and inflammation, particularly in conditions like atopic dermatitis, which is prevalent in dogs [2].

One of the primary functions of IL13 is its involvement in the Th2 immune response, which is characterized by the production of IgE and the activation of eosinophils. This response is essential for combating parasitic infections but can lead to allergic reactions when dysregulated [3]. In the context of canine health, variations in the IL13 gene have been linked to atopic dermatitis, suggesting that specific polymorphisms may alter the protein's function and contribute to disease susceptibility [2]. The variant Ala81 of canine IL13 is predicted to significantly affect its conformation and function, potentially influencing the severity of allergic responses [2].

IL13 also plays a pivotal role in tissue remodeling and fibrosis. It promotes the differentiation of fibroblasts into myofibroblasts, which are involved in collagen deposition and tissue repair processes [4]. This function is particularly relevant in chronic inflammatory conditions where excessive fibrosis can lead to organ dysfunction. In dogs, as in other mammals, IL13 signaling is mediated through its receptors, primarily IL13Rα1 and IL13Rα2, which activate downstream signaling pathways such as JAK/STAT6, leading to the transcription of genes associated with inflammation and fibrosis [5][6].

Moreover, IL13 has been shown to influence the behavior of various immune cells in the central nervous system (CNS). Studies indicate that IL13 can modulate microglial activation and promote an anti-inflammatory environment, which is beneficial in neuroinflammatory conditions [7][8]. This suggests a broader role for IL13 beyond peripheral immune responses, extending into neuroimmune interactions, which may have implications for conditions affecting the CNS in dogs.

References:
[1] A. Brahimaj, S. Ligthart, M. Ghanbari, M. Ikram, A. Hofman, O. Franco, et al. Novel inflammatory markers for incident pre-diabetes and type 2 diabetes: the rotterdam study, European Journal of Epidemiology, vol. 32, no. 3, p. 217-226, 2017. https://doi.org/10.1007/s10654-017-0236-0
[2] K. Tanaka, M. Yamamoto-Fukuda, T. Takizawa, H. Shimakura, & M. Sakaguchi. Association analysis of non-synonymous polymorphisms of interleukin-4 receptor-α and interleukin-13 genes in canine atopic dermatitis, Journal of Veterinary Medical Science, vol. 82, no. 9, p. 1253-1259, 2020. https://doi.org/10.1292/jvms.20-0301
[3] F. Vladich, S. Brazille, D. Stern, M. Peck, R. Ghittoni, & D. Vercelli. Il-13 r130q, a common variant associated with allergy and asthma, enhances effector mechanisms essential for human allergic inflammation, Journal of Clinical Investigation, vol. 115, no. 3, p. 747-754, 2005. https://doi.org/10.1172/jci22818
[4] A. Adhyatmika, K. Putri, E. Gore, K. Mangnus, C. Reker‐Smit, D. Schuppan, et al. Osteoprotegerin expression in liver is induced by il-13 through tgf-β,, 2020. https://doi.org/10.1101/2020.12.11.421479
[5] G. Li, A. Wu, D. Qi, F. Cui, Y. Zeng, F. Xie, et al. Differential effects of peptidoglycan on colorectal tumors and intestinal tissue post-pelvic radiotherapy, Oncotarget, vol. 7, no. 46, p. 75685-75697, 2016. https://doi.org/10.18632/oncotarget.12353
[6] L. Hsi, S. Kundu, J. Palomo, B. Xu, R. Ficco, M. Vogelbaum, et al. Silencing il-13rα2 promotes glioblastoma cell death via endogenous signaling, Molecular Cancer Therapeutics, vol. 10, no. 7, p. 1149-1160, 2011. https://doi.org/10.1158/1535-7163.mct-10-1064
[7] S. Taj, D. Blon, C. Hoornaert, J. Daans, A. Quarta, J. Praet, et al. Targeted intracerebral delivery of the anti-inflammatory cytokine il13 promotes alternative activation of both microglia and macrophages after stroke, Journal of Neuroinflammation, vol. 15, no. 1, 2018. https://doi.org/10.1186/s12974-018-1212-7
[8] D. Blon, C. Guglielmetti, C. Hoornaert, A. Quarta, J. Daans, D. Dooley, et al. Intracerebral transplantation of interleukin 13-producing mesenchymal stem cells limits microgliosis, oligodendrocyte loss and demyelination in the cuprizone mouse model, Journal of Neuroinflammation, vol. 13, no. 1, 2016. https://doi.org/10.1186/s12974-016-0756-7

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
Subcellular Location
Secreted.
Protein Families
IL-4/IL-13 family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*