Recombinant Human Mothers against decapentaplegic homolog 3 (SMAD3)

In Stock
Code CSB-EP021788HUb0
Abbreviation Recombinant Human SMAD3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Transcription
Alternative Names
MAD homolog 3;Mad3;Mothers against DPP homolog 3;hMAD-3;JV15-2;SMAD family member 3;SMAD 3;Smad3;hSMAD3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-425aa
Target Protein Sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human SMAD3 is a full-length protein expressed in E. coli, spanning amino acids 1 to 425. This product comes with an N-terminal 10xHis-tag, which makes purification and detection much simpler. The protein achieves a purity level above 90%, confirmed through SDS-PAGE analysis. Intended for research use only, this recombinant SMAD3 appears to be a solid choice for scientific studies that need high-quality proteins with minimal endotoxin contamination.

SMAD3 acts as a critical intracellular mediator in the TGF-beta signaling pathway. It plays a significant role in regulating various cellular processes—proliferation, differentiation, and apoptosis among them. As a transcription factor, SMAD3 transmits extracellular signals to the nucleus, where it influences gene expression. Its involvement in these pathways likely makes it an essential protein for research into cellular communication and regulatory mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human SMAD3 is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing properly folded eukaryotic signaling proteins like SMAD3. SMAD3 requires precise folding of its MH1 and MH2 domains, proper oligomerization capabilities, and specific post-translational modifications for its transcriptional co-activator function in TGF-β signaling. While the protein is full-length (1-425aa) with an N-terminal 10xHis tag and >90% purity, E. coli lacks the eukaryotic chaperones and modification machinery necessary for the correct folding of complex signal transduction proteins. The presence of the His-tag may further interfere with native protein structure and function. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its DNA-binding capability, SMAD4 interaction, and phosphorylation responsiveness.

1. Protein-Protein Interaction Studies via His-Tag Pull-Down Assays

The N-terminal 10xHis tag enables technical immobilization for pull-down assays, but if SMAD3 is misfolded (as likely in E. coli), it will not interact physiologically with true binding partners (e.g., SMAD4, receptor complexes). The MH2 domain requires precise conformation for specific oligomerization. Identified interactions may be non-physiological artifacts. This application should only be pursued after confirming proper folding and SMAD4 interaction capability.

2. Antibody Development and Validation

This application is appropriate as the safest use case. The recombinant SMAD3 can serve as an effective immunogen for generating antibodies that recognize linear epitopes, even if misfolded. The full-length sequence ensures broad epitope coverage. However, antibodies may not recognize conformational or phosphorylation-dependent epitopes of native SMAD3. Validation against phosphorylated, endogenous SMAD3 from mammalian cells is essential.

3. Biochemical Characterization and Biophysical Analysis

This application is well-suited and should be prioritized. Techniques like circular dichroism spectroscopy, analytical ultracentrifugation, and thermal shift assays can directly assess the protein's folding state, oligomerization behavior, and stability. These studies are valuable even if the protein is inactive, as they characterize the recombinant product itself and inform about its suitability for other applications.

4. In Vitro Binding Assays with TGF-β Pathway Components

This application is highly problematic without activity verification. If SMAD3 is misfolded, it will not bind DNA properly via its MH1 domain or interact specifically with SMAD4 via its MH2 domain. Binding assays will yield misleading affinity data. This application requires prior validation of DNA-binding and SMAD4 interaction capabilities using known response elements and binding partners.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this complex eukaryotic signaling protein, we recommend first performing comprehensive biophysical and functional validation. This should include: 1) Biophysical characterization (circular dichroism for secondary structure, size-exclusion chromatography with multi-angle light scattering for oligomeric state); 2) Functional validation (DNA-binding assays using SMAD-responsive elements, SMAD4 interaction tests). Antibody development can proceed immediately as the lowest-risk application. Avoid all interaction and binding studies until proper folding and function are confirmed. For reliable SMAD3 functional studies, consider obtaining the protein from mammalian or insect cell expression systems capable of proper folding and post-translational modifications. Always include appropriate controls such as known SMAD3-responsive DNA elements and validated binding partners.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.
Gene References into Functions
  1. Study established a relationship between OCT4 and SMAD3 heterodimers formation and Snail, Slug, and CXCL13 transcription promotion mediating breast cancer progression. PMID: 29526821
  2. Study results using gene editing indicate the cancer-promoting role of Smad3 T179 phosphorylation in the human triple-negative breast cancer cells. PMID: 30251686
  3. Downregulation of miR-637 promotes proliferation and migration of fibroblasts by targeting Smad3 in keloids. PMID: 29845237
  4. The findings of the present study indicated that miR326 inhibited endometrial fibrosis by suppressing the TGFbeta1/Smad3 signaling pathway, suggesting that miR326 may be a prognostic biomarker and therapeutic target for Intrauterine adhesion (IUA). PMID: 29956752
  5. Study validated a specific model prediction that SMAD3 regulates Huntington's disease (HD)-related gene expression changes. Also, results found CAG repeat length-dependent changes in the genomic occupancy of SMAD3 and confirmed the model's prediction that many SMAD3 target genes are downregulated early in HD. PMID: 29581148
  6. The SMAD3 rs12901499 polymorphism may be involved in the development of knee osteoarthritis. Larger studies with more diverse ethnic populations are needed to confirm these result. PMID: 29315792
  7. NLRC5 may act as a key mediator in renal fibroblast activation and fibrogenesis PMID: 29608899
  8. The SMAD3 SNP rs12901499 GA genotype and G variant may increase the risk of hip osteoarthritis in Chinese Han patients. PMID: 29310478
  9. Positive cooperativity of Smad3 and STAT3 during epithelial-mesenchymal transition [Review]. PMID: 29140406
  10. CXCL12 activates the MEKK1/JNK signaling pathway, which in turn initiates SMAD3 phosphorylation, its translocation to nuclei, and recruitment of SMAD3 to the CTGF promoter, which ultimately induces CTGF expression in human lung fibroblasts. PMID: 29499695
  11. these results indicated that Bone marrow-derived mesenchymal stem cells -conditioned medium suppressed the epithelial-mesenchymal transition which might be associated with TGF-B1/Smad3. This study provides the theoretical basis for the research of the mechanisms responsible for pulmonary disease. PMID: 29207055
  12. The present findings indicate that RACK1 silencing attenuates renal fibrosis by suppressing the activation of TGF-beta1/Smad3 signaling pathway in HK-2 cells. Thus, RACK1 may serve as a novel regulator of renal fibrosis. PMID: 29039466
  13. MSP analysis from 81 Acute coronary syndrome (ACS)samples, 74 SCAD samples and 53 healthy samples, and Sequenom MassARRAY analysis, confirmed that differential CpG methylation of SMAD3 was significantly corrected with the reference results of the HumanMethylation450 array. PMID: 29115576
  14. Smad3 knockdown could restore the inhibition of cell proliferation induced by FSTL1 overexpression in MDAMB231FSTL1 cells, indicating that the antiproliferative effect of FSTL1 overexpression may be associated with Smad3 involved TGFbeta signaling pathway regulation. This study identified FSTL1 as an inhibitor of cell proliferation in MDAMB231 and 231BR cell lines PMID: 29048681
  15. miR-195 inhibited proliferation and induced apoptosis of vascular smooth muscle cells, which was abated by Smad3 overexpression PMID: 28665537
  16. SMAD3 SNP rs422342 is statistically associated with intervertebral disc degeneration in Greek population. PMID: 28662992
  17. we observed that SMAD3 rs1065080 single nucleotide gene polymorphisms were significantly associated with patient susceptibility to intracranial arterial aneurysms PMID: 28988651
  18. Smad3 binds with type I TGF-beta receptor (TRI) even in unstimulated cells. PMID: 27641076
  19. This study demonstrates that Smad3 protein had low expression in ACTH-Pituitary Adenoma Development. PMID: 29524699
  20. data suggest that TGF-beta stimulated the expression of ChPF and sGAG synthesis in nucleus pulposus cells through Smad3, RhoA/ROCK1 and the three MAPK signaling pathways. PMID: 28608941
  21. These results suggested that FXR may serve as an important negative regulator for manipulating Smad3 expression, and the FXR/Smad3 pathway may be a novel target for the treatment of renal fibros PMID: 27853248
  22. SMad3 role in TGF-beta/SMAD pathway signal transduction PMID: 28320972
  23. ERK1/2 mediates Heme oxygenase-1 or CO-induced Smad3 phosphorylation at Thr179. PMID: 29524413
  24. Participants' data and peripheral blood samples were collected, and three Smad3 CpG loci were examined. Smad3 mRNA expression was significantly higher in the patient group than in the negative control group but did not differ between the two control groups. PMID: 28562330
  25. The critical roles of miR-16-5p-Smad3 pathway in melatonin-induced growth defects of gastric cancers. PMID: 29359963
  26. TGFbeta1 signalling is associated with activation of SMAD3 at the ciliary base. PMID: 27748449
  27. exaggerated WNT-5B expression upon cigarette smoke exposure in the bronchial epithelium of COPD patients leads to TGF-beta/Smad3-dependent expression of genes related to airway remodelling PMID: 27126693
  28. HSF1 activity is decreased in fibrotic hearts. HSF1 inhibits phosphorylation and nuclear distribution of Smad3 via direct binding to Smad3. Active Smad3 blocks the anti-fibrotic effect of HSF1. PMID: 28091697
  29. miR-142-5p plays as a negative regulator in TGF-beta pathway by targeting SMAD3 and suppresses TGF-beta-induced growth inhibition in cancer cells. PMID: 27683030
  30. Authors were able to confirm expression of SMAD3 in intact and degraded cartilage of the knee and hip. Our findings provide the first systematic evaluation of pleiotropy between OA and BMD, highlight genes with biological relevance to both traits, and establish a robust new OA genetic risk locus at SMAD3. PMID: 28934396
  31. A bioinformatics analysis and luciferase reporter assay identified Smad3 as a direct target gene of miR-216b, and Smad3 expression was reduced by miR-216b overexpression at both the mRNA and protein levels. PMID: 28356485
  32. Because the expression of these genes correlates with cell shape, these are likely mechanosensitive genes that regulate SMAD3 and/or RELA activation in response to mechanical cues PMID: 27864353
  33. SMAD3 transcription facttor binds RNA with large internal loops or bulges with high apparent affinity, suggesting a biological role for RNA binding by SMAD3. PMID: 29036649
  34. Case Report: internal mammary artery aneurysms in sisters with SMAD3 mutation. PMID: 28286188
  35. High Smad3 expression is associated with invasion and metastasis in pancreatic ductal adenocarcinoma. PMID: 26908446
  36. New evidence suggests that SMAD3 activation may serve as a critical converging point of dysregulated TGFB superfamily signaling and genetic aberrations in human granulosa cell tumor development (review). PMID: 27683263
  37. We find that DIGIT is divergent to Goosecoid (GSC) and expressed during endoderm differentiation. Deletion of the SMAD3-occupied enhancer proximal to DIGIT inhibits DIGIT and GSC expression and definitive endoderm differentiation. PMID: 27705785
  38. ANP inhibits TGF-beta1-induced EMT in 16HBE-14o and A549 cells through cGMP/PKG signaling, by which it targets TGF-beta1/Smad3 via attenuating phosphorylation of Smad3. These findings suggest the potential of ANP in the treatment on pulmonary diseases with airway remodeling. PMID: 28229930
  39. Sec8 regulates N-cadherin expression by controlling Smad3 and Smad4 expression through CBP, thereby mediating the epithelial-mesenchymal transition. PMID: 27769780
  40. Particularly, galangin effectively inhibits phosphorylation of the Thr-179 site at Smad3 linker region through suppression of CDK4 phosphorylation. Thus, galangin can be a promising candidate as a selective inhibitor to suppress phosphorylation of Smad3 linker region. PMID: 29097203
  41. Up-regulation of miR-195 suppressed cell migration and invasion in vitro. Smad3 was verified as a direct target of miR-195, which was further confirmed by the inverse expression of miR-195 and Smad3 in patients' specimens. PMID: 27206216
  42. In human primary tubular epithelial cells, inhibition of HIF sensing prolylhydroxylases by DMOG or exposure of the cells to hypoxia upregulated Smad3 expression and enhanced its translocation to the nucleus. PMID: 27155083
  43. Findings demonstrate that TGFbeta1 allows tumors to evade host immune responses in part through enhanced SMAD3-mediated PD-1 expression on tumor infiltrating lymphocytes. PMID: 27683557
  44. Store-operated calcium entry via Orai1 in mesangial cells negatively regulates the TGF-beta1/Smad3 signaling pathway. PMID: 28637791
  45. TF-induced microvessel stabilization is regulated via PAR2-SMAD3 that is indispensable for the maintenance of vascular integrity. PMID: 26658897
  46. stablish PPM1A as a novel repressor of the SMAD3 pathway in renal fibrosis PMID: 27328942
  47. Methylation in SMAD3 was selectively increased in asthmatic children of asthmatic mothers and was associated with childhood asthma risk PMID: 28011059
  48. a direct crosstalk between the STAT3 and Smad3 signaling pathways that may contribute to tumor development and inflammation. PMID: 26616859
  49. It is reported here that TGF-beta directly regulates alternative splicing of cancer stem cell marker CD44 through a phosphorylated threonine179 of SMAD3-mediated interaction with RNA-binding protein PCBP1. PMID: 27746021
  50. Bcl-3 knockdown enhanced the degradation of Smad3 but not Smad2 following TGFbeta treatment. PMID: 27906182

Show More

Hide All

Involvement in disease
Colorectal cancer (CRC); Loeys-Dietz syndrome 3 (LDS3)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Dwarfin/SMAD family
Database Links

HGNC: 6769

OMIM: 114500

KEGG: hsa:4088

STRING: 9606.ENSP00000332973

UniGene: Hs.727986

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*