Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-BP021788HU |
| Product Type | Recombinant Protein |
| Size | US$1972 |
| Uniprot No. | P84022 |
| Lead Time | 3-7 business days |
| Relevance | Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE elent in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS |
| Research Area | Transcription |
| Source | Baculovirus |
| Gene Names | SMAD3 |
| Protein Names | JV15-2SMAD family member 3 ;SMAD 3 ;Smad3 ;hSMAD3 |
| Expression Region | 1-425aa |
| Tag Info | N-terminal 10xHis-tagged |
| Mol. Weight | 50.6 kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator. |
| Involvement in disease | Colorectal cancer (CRC); Loeys-Dietz syndrome 3 (LDS3) |
| Subcellular Location | Cytoplasm, Nucleus |
| Protein Families | Dwarfin/SMAD family |
| Database Links |
HGNC: 6769 OMIM: 114500 KEGG: hsa:4088 STRING: 9606.ENSP00000332973 UniGene: Hs.727986 |
| Pathway |
Hippo signaling pathway
TGF-beta signaling pathway Wnt signaling pathway Cell cycle Cellular senescence Signaling pathways regulating pluripotency of stem cells Th17 cell differentiation AGE-RAGE signaling pathway in diabetic complications Apelin signaling pathway FoxO signaling pathway Endocytosis |
SMAD3 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA021788GA01HU | SMAD3 Antibody | Human | ELISA,WB,IHC |
| CSB-PA021788LB01HU | SMAD3 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA021788LC01HU | SMAD3 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA021788LD01HU | SMAD3 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA620192 | Phospho-SMAD3 (Ser208) Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA103091 | SMAD3 (Ab-204) Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA898915 | Phospho-SMAD3 (Ser425) Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA440262 | SMAD3 (Ab-208) Antibody | Human,Mouse,Rat | ELISA,IHC,IF |
| CSB-PA794085 | SMAD3 (Ab-425) Antibody | Human,Mouse,Rat | ELISA,IHC,IF |
| CSB-PA909608 | Phospho-SMAD3 (Ser204) Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA282191 | Phospho-SMAD3 (Ser213) Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA905682 | Phospho-SMAD3 (Thr179) Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA000651 | Phospho-SMAD3 (S204) Antibody | Human,Mouse,Rat | WB,IHC,IF,ELISA |
| CSB-PA000676 | Phospho-SMAD3 (S425) Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA000711 | Phospho-SMAD3 (S208) Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA004113 | SMAD3 Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA004115 | SMAD3 Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA009957 | Phospho-SMAD3 (S213) Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA009959 | Phospho-SMAD3 (T179) Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA009960 | SMAD3 Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA080212 | SMAD3 Antibody | Human,Mouse,Rat | WB,IHC |
| CSB-PA080213 | SMAD3 Antibody | Human | WB,IHC |
| CSB-PA039919 | SMAD3 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA033427 | SMAD3 Antibody | Human,Mouse,Rat | ELISA,IHC |
SMAD3 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA021788LA01HU | SMAD3 Antibody | Human | ELISA, WB |
| CSB-PA021788ESR2HU | SMAD3 Antibody | Human | ELISA, WB, IHC, IF, IP |
SMAD3 Antibodies for
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-MA388929 | Phospho-SMAD3(S425) Monoclonal Antibody | Human,Mouse,Rat | ELISA,IHC |
SMAD3 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP021788HU CSB-MP021788HU |
Recombinant Human Mothers against decapentaplegic homolog 3(SMAD3) | Yeast Mammalian cell |
| CSB-EP021788HU | Recombinant Human Mothers against decapentaplegic homolog 3(SMAD3) | E.coli |
SMAD3 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E15764h | Human Mothers Against Decapentaplegic Homolog 3(SMAD3) ELISA Kit | serum, plasma, tissue homogenates, cell lysates | 19.5 pg/mL |
Recombinant Human BPI fold-containing family A member 2(BPIFA2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein Rab-4A(RAB4A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Plasma kallikrein(KLKB1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human 60S acidic ribosomal protein P0(RPLP0)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Coagulation factor XIII A chain(F13A1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Bovine L-2-hydroxyglutarate dehydrogenase, mitochondrial(L2HGDH)
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human Protein ETHE1, mitochondrial(ETHE1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Cynops pyrrhogaster Annexin A5
Express system: E.coli
Species: Cynops pyrrhogaster (Japanese fire-bellied newt)
