Recombinant Human Transforming protein RhoA(RHOA),partial

Code CSB-RP008754h
Product Type Recombinant Protein
Size US$162
Uniprot No. P61586
Relevance Regulates a signal transduction pathway linking plasma mbrane receptors to the assbly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. Stimulates PKN2 kinase activity. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assbly and disassbly. The MO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell mbrane, via the regulation of GSK3B activity. In turn, mbrane-bound APC allows the localization of the MACF1 to the cell mbrane, which is required for microtubule capture and stabilization.Regulates a signal transduction pathway linking plasma mbrane receptors to the assbly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assbly and disassbly. The MO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell mbrane, via the regulation of GSK3B activity. In turn, mbrane-bound APC allows the localization of the MACF1 to the cell mbrane, which is required for microtubule capture and stabilization . Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Rho cDNA clone 12 ;h12
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCL
Research Area Cell Cycle
Source E.coli
Gene Names RHOA
Expression Region 1-191aa
Tag Info N-terminal GST-tagged
Mol. Weight 48.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Stimulates PKN2 kinase activity. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization (By similarity). Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis
Subcellular Location Cell membrane, Lipid-anchor, Cytoplasmic side, Cytoplasm, cytoskeleton, Cleavage furrow, Cytoplasm, cell cortex, Midbody, Cell projection, lamellipodium
Protein Families Small GTPase superfamily, Rho family
Database Links

HGNC: 667

OMIM: 165390

KEGG: hsa:387

STRING: 9606.ENSP00000400175

UniGene: Hs.247077

Pathway cAMP signaling pathway
Chemokine signaling pathway
mTOR signaling pathway
TGF-beta signaling pathway
Wnt signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Vascular smooth muscle contraction
Adherens junction
Ras signaling pathway
Leukocyte transendothelial migration
NOD-like receptor signaling pathway
T cell receptor signaling pathway
cGMP-PKG signaling pathway
Oxidative Phosphorylation
Phospholipase D signaling pathway
Rap1 signaling pathway
Sphingolipid signaling pathway
Endocytosis
Inhibitors of axonal regeneration
Neurotrophin signaling pathway

Related Products

RHOA Antibodies

RHOA Antibodies for Human

RHOA Antibodies for Homo sapiens (Human)

RHOA Proteins

RHOA Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.