Recombinant Human papillomavirus type 6a protein E4 (E4)

In Stock
Code CSB-EP772797HOM
Abbreviation Recombinant Human papillomavirus type 6a E4 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
E4
Uniprot No.
Research Area
Others
Species
Human papillomavirus type 6a
Source
E.coli
Expression Region
1-91aa
Target Protein Sequence
MADDSALHKKYPFLNLLHTPPHRPPPLCPQAPRKTQCKRRLENEHEESNSHLATPCVWPTLDPWTVETTTSSLTITTSTKEGTTVTVQLRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human papillomavirus type 6a protein E4 is expressed in E. coli and consists of the full-length protein with an expression region from 1 to 91 amino acids. This product features an N-terminal 10xHis-tag and a C-terminal Myc-tag, which streamlines purification and detection processes. SDS-PAGE analysis indicates a purity level greater than 85%, making it suitable for research applications where high-quality protein is essential.

The E4 protein from Human papillomavirus type 6a appears to play a crucial role in the viral life cycle, particularly in regulating viral replication and modulating cell cycle progression. Research suggests it's significant for understanding viral mechanisms and pathogenesis. Scientists often examine this protein to gain insights into the complex interactions between viral and host cellular components. Studies indicate E4 may be involved in viral assembly and release, which likely contributes to its importance in virology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant Human papillomavirus type 6a E4 protein (1–91aa, full length) was expressed in E. coli with dual tags (N-terminal 10×His and C-terminal Myc). E4 proteins are small, highly coiled-coil or partially disordered viral regulatory proteins that often require host post-translational modifications or chaperone-mediated folding to reach their native structure. Since E. coli lacks eukaryotic folding machinery and phosphorylation systems involved in E4 regulation, the recombinant form is likely soluble but partially misfolded or lacking proper post-translational features. Therefore, while it may retain some native-like secondary structure, it is unlikely to possess full biological activity or proper conformation identical to viral E4 in host cells. The protein remains, however, useful for antibody generation, immunoassays, and qualitative binding screens where native enzymatic activity is not required.

1. Antibody Development and Validation

The recombinant E4 protein is well-suited for antibody generation. The >85% purity and full-length nature make it appropriate for use as an antigen. If correctly folded, it will induce antibodies recognizing native conformational epitopes. If misfolded, it will still generate antibodies against linear epitopes, suitable for Western blot, ELISA, or immunodetection applications, though not necessarily recognizing native E4 in cells. The dual-tag system aids purification, quantification, and validation of antibody specificity using anti-Myc or anti-His controls.

2. Biochemical Characterization and Structural Studies

While this E4 preparation can be used for basic physicochemical characterization (e.g., CD spectroscopy or DLS), its bacterial origin makes it unsuitable for high-resolution structural or functional assays that require post-translationally modified or folded protein. If partial folding is achieved, secondary structure estimations or stability profiling may still provide useful insights into the intrinsic disorder of E4. However, enzymatic or regulatory function studies are not recommended, as bacterial expression likely prevents proper conformational maturation.

3. ELISA-Based Quantitative Assays

This dual-tagged E4 protein can serve as a standard or positive control in ELISA assays detecting HPV6a E4 antibodies or measuring recombinant protein levels in expression studies. If partially folded, it can be reliably used in quantitative or comparative assays where absolute conformational fidelity is not critical. If misfolded, it may still function as a calibration antigen or assay control, provided that the detection antibodies target linear epitopes or tag sequences. Hence, it remains valuable for assay standardization and detection method validation, but not for functional ELISA studies requiring native-like conformation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions.
Subcellular Location
Host cytoplasm. Host nucleus.
Protein Families
Papillomaviridae E4 protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*