Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial

In Stock
Code CSB-EP011930MO
Abbreviation Recombinant Mouse Jak1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Jak1; Tyrosine-protein kinase JAK1; EC 2.7.10.2; Janus kinase 1; JAK-1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
848-1152aa
Target Protein Sequence
EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1) is expressed in E. coli with an N-terminal 6xHis-tag that simplifies purification. This partial protein covers amino acids 848-1152 and shows purity levels above 90%, confirmed through SDS-PAGE analysis. Designed strictly for research purposes, this product offers scientists a useful tool for investigating kinase function and signaling pathways.

JAK1 appears to play a vital role in how various cytokines and growth factors communicate within cells. Being part of the Janus kinase family, JAK1 seems responsible for phosphorylating and activating STAT proteins—signal transducer and activator of transcription proteins that carry messages from cell surfaces to the nucleus. Understanding this protein may be essential for grasping how cells respond and regulate themselves, particularly in immune and blood-forming systems.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse JAK1 is a complex tyrosine kinase that requires precise folding, proper ATP-binding site formation, specific activation loop conformation, and regulatory phosphorylation for its enzymatic activity. The E. coli expression system cannot provide the eukaryotic folding environment or post-translational modifications (particularly activation loop phosphorylation) necessary for full kinase activity. The partial fragment (848-1152aa) represents the kinase domain but lacks critical N-terminal FERM and SH2 domains essential for proper regulation and substrate recognition. The N-terminal 6xHis-tag may sterically interfere with the protein's functional domains. While the kinase domain may be soluble, the probability of correct folding with functional kinase activity requires experimental validation.

1. In Vitro Kinase Activity Assays

This application carries a significant risk without functional validation. JAK1 kinase activity requires the precise formation of the ATP-binding site, proper activation loop conformation, and regulatory phosphorylation, which may be compromised in this expression system. If correctly folded and active (verified through autophosphorylation assays), the protein may be suitable for kinetic studies. If misfolded/inactive (unverified), kinase assays will yield biologically meaningless results.

2. JAK1-Specific Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional kinase activity. The kinase domain fragment provides specific epitopes for generating antibodies against JAK1. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

3. Protein-Protein Interaction Studies

This application requires proper folding validation. JAK1 interactions with substrates and regulatory proteins require precise tertiary structure. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine signaling complex formation.

4. Biophysical Characterization

These studies are essential for determining folding status. Techniques should include size-exclusion chromatography to assess oligomeric state, circular dichroism spectroscopy to evaluate secondary structure, and thermal shift assays to determine stability. However, the His-tag may interfere with high-resolution structural studies.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally limited for producing a functionally active JAK1 kinase due to its inability to support proper eukaryotic folding and post-translational modifications. Begin with Application 4 (Biophysical Characterization) to assess folding quality through SEC, CD spectroscopy, and validate kinase activity through autophosphorylation assays before considering functional applications. Applications 1 and 3 require rigorous functional validation. Application 2 (antibody development) can proceed immediately. For reliable JAK1 research requiring native functionality, use a mammalian expression systems that support proper kinase folding, activation loop phosphorylation, and regulatory domain interactions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor as well as interleukin (IL)-10 receptor. Directly phosphorylates STAT but also activates STAT signaling through the transactivation of other JAK kinases associated with signaling receptors.
Subcellular Location
Endomembrane system; Peripheral membrane protein. Note=Wholly intracellular, possibly membrane associated.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*