Recombinant Human Tumor necrosis factor(TNF),partial (Active)

In Stock
Code CSB-AP004881HU
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 1 ng/ml.
Target Names TNF
Uniprot No. P01375
Research Area Cancer
Alternative Names Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; TNF; TNFA; TNFSF2
Species Homo sapiens (Human)
Source E.coli
Expression Region 57-233aa
Complete Sequence GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Mol. Weight 21.8 kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 100 mM NaCl, pH 7.2
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Target Data

Function Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective
Involvement in disease Psoriatic arthritis (PSORAS)
Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families Tumor necrosis factor family
Database Links

HGNC: 11892

OMIM: 191160

KEGG: hsa:7124

STRING: 9606.ENSP00000398698

UniGene: Hs.241570

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.