Recombinant Human Tumor necrosis factor(TNF),partial

In Stock
Code CSB-AP004881HU
Product Type Tumor Necrosis Factor
Size US$195
Uniprot No. P01375
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 100 mM NaCl, pH 7.2
Alias Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; TNF; TNFA; TNFSF2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 1 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Research Area Cancer
Source E.coli
Gene Names TNF
Expression Region 57-233aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 21.8 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective
Involvement in disease Psoriatic arthritis (PSORAS)
Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families Tumor necrosis factor family
Database Links

HGNC: 11892

OMIM: 191160

KEGG: hsa:7124

STRING: 9606.ENSP00000398698

UniGene: Hs.241570

Pathway MAPK signaling pathway
mTOR signaling pathway
TGF-beta signaling pathway
NF-kappa B signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Antigen processing and presentation
Fc epsilon RI signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Osteoclast differentiation
T cell receptor signaling pathway
Toll-like receptor signaling pathway
Adipocytokine signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Inflammatory Pain

Related Products

TNF Antibodies

TNF Antibodies for Homo sapiens (Human)

TNF Antibodies for Human

TNF ELISA Kit

TNF ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.