Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40),partial

In Stock
Code CSB-AP005171HU
Product Type Immune Checkpoint
Size US$65
Uniprot No. P25942
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human TNFSF5 in functional ELISA is less than 100 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Research Area Immunology
Source Mammalian cell
Gene Names CD40
Expression Region 21-193aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 20.2 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
Involvement in disease Immunodeficiency with hyper-IgM 3 (HIGM3)
Subcellular Location Isoform I: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform II: Secreted
Tissue Specificity B-cells and in primary carcinomas.
Database Links

HGNC: 11919

OMIM: 109535

KEGG: hsa:958

STRING: 9606.ENSP00000361359

UniGene: Hs.472860

Pathway NF-kappa B signaling pathway
Toll-like receptor signaling pathway

Related Products

CD40 Antibodies

CD40 Antibodies for Homo sapiens (Human)

CD40 Antibodies for Human

CD40 Proteins

CD40 Proteins for Homo sapiens (Human)

CD40 Proteins for Bos taurus (Bovine)

CD40 Proteins for Callithrix jacchus (White-tufted-ear marmoset)

CD40 Proteins for Equus caballus (Horse)

CD40 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

CD40 Proteins for Sus scrofa (Pig)

CD40 Proteins for Mus musculus (Mouse)

CD40 cDNA

CD40 cDNA for Callithrix jacchus (White-tufted-ear marmoset)

CD40 cDNA for Equus caballus (Horse)

CD40 cDNA for Canis lupus familiaris (Dog) (Canis familiaris)

CD40 cDNA for Sus scrofa (Pig)

CD40 ELISA Kit

CD40 ELISA Kit for Homo sapiens (Human)

CD40 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.