Code | CSB-MP004936HU1 |
Size | $278 How to order? |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The product CSB-MP004936HU1 is a recombinant protein of TNFRSF5 (CD40) (21-193AA) coupled to the Fc portion of human IgG1 Fc. This C-terminally hFc-tagged CD40 protein is an active protein, whose bioactivity has been demonstrated through a functional ELISA (bind to CD40L with the EC50 of 3.112-3.858 ng/ml) and an LSPR assay (bind to the CD40L with an affinity constant of 2.06 nM). Its purity reaches over 92% measured by SDS-PAGE. It contains less endotoxin, <1.0 EU/ug protein determined by the LAL method. And it is in stock now. CD40-CD40L interaction plays an important role in the regulation of B cell functions, generation and survival of long-lived plasma cells and memory B cells, as well as adaptive immune responses. |
Purity | Greater than 92% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | ①Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L (CSB-MP004937HU3), the EC50 is 3.112-3.858 ng/ml.②Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay. |
Target Names | CD40 |
Uniprot No. | P25942 |
Alternative Names | CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 21-193aa |
Target Protein Sequence | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
Mol. Weight | 48.0 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
|
Gene References into Functions |
|
Involvement in disease | Immunodeficiency with hyper-IgM 3 (HIGM3) |
Subcellular Location | [Isoform I]: Cell membrane; Single-pass type I membrane protein.; [Isoform II]: Secreted. |
Tissue Specificity | B-cells and in primary carcinomas. |
Database Links |
HGNC: 11919 OMIM: 109535 KEGG: hsa:958 STRING: 9606.ENSP00000361359 UniGene: Hs.472860 |