Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L (CSB-MP004937HU3), the EC50 is 3.112-3.858 ng/ml.②Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay.
Alternative Names
CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
21-193aa
Target Protein Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The product CSB-MP004936HU1 is a recombinant protein of TNFRSF5 (CD40) (21-193AA) coupled to the Fc portion of human IgG1 Fc. This C-terminally hFc-tagged CD40 protein is an active protein, whose bioactivity has been demonstrated through a functional ELISA (bind to CD40L with the EC50 of 3.112-3.858 ng/ml) and an LSPR assay (bind to the CD40L with an affinity constant of 2.06 nM). Its purity reaches over 90% measured by SDS-PAGE. It contains less endotoxin, <1.0 EU/ug protein determined by the LAL method. And it is in stock now.
CD40-CD40L interaction plays an important role in the regulation of B cell functions, generation and survival of long-lived plasma cells and memory B cells, as well as adaptive immune responses.