Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial (Active)

In Stock Promotion
Code CSB-MP004936HU1
Abbreviation Recombinant Human CD40 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,780+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L (CSB-MP004937HU3), the EC50 is 3.112-3.858 ng/ml. Biological Activity Assay
  • Activity
    Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay. Biological Activity Assay
  • The purity of CD40 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L (CSB-MP004937HU3), the EC50 is 3.112-3.858 ng/ml.②Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay.
Target Names
Uniprot No.
Alternative Names
CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-193aa
Target Protein Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Mol. Weight
48.0 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human CD40 protein is produced by expressing a plasmid in mammalian cells that encodes the amino acid sequence from 21 to 193 of the human CD40. A hFc-tag is attached to the C-terminus of the protein. SDS-PAGE analysis measures the purity of this CD40 protein at greater than 95%, while LAL testing confirms its endotoxin levels are below 1.0 EU/μg. ELISA validates its biological activity, with this CD40 protein binding to CD40L (CSB-MP004937HU3) at an EC50 between 3.112 and 3.858 ng/mL. In the LSPR assay, this human CD40 protein captured on the COOH chip binds to the human CD40L protein (CSB-MP004937HU3) with an affinity constant of 2.06 nM.

Human TNFRSF5 (CD40) is a type I transmembrane glycoprotein primarily expressed on various immune cells, including B lymphocytes, dendritic cells, and macrophages [1][2]. It plays a crucial role in the immune system. CD40 is essential for mediating costimulatory signals that enhance the activation and differentiation of B cells, thereby facilitating effective immune responses [3].

Upon binding of its ligand CD40L (CD154), CD40 undergoes conformational changes that lead to the recruitment of intracellular adaptor proteins known as TNF receptor-associated factors (TRAFs), which initiate downstream signaling cascades [4][5]. This signaling is crucial for processes such as B cell proliferation, isotype switching, and the generation of memory B cells, which are vital for long-term immunity [5]. Furthermore, CD40 signaling is implicated in the regulation of cytokine production, influencing the inflammatory response and the development of various immune-mediated conditions [2].

CD40 has also been implicated in various pathological conditions, including cancer and autoimmune diseases. Aberrant CD40 signaling can contribute to tumor progression by promoting an inflammatory microenvironment that supports tumor growth and metastasis [6]. In non-small cell lung cancer (NSCLC), CD40 expression has been associated with clinical outcomes, suggesting that it may serve as a potential therapeutic target [7]. Moreover, CD40 is involved in the pathogenesis of diabetic retinopathy, where its activation leads to enhanced inflammatory responses in retinal cells [8].

References:
[1] F. Dimitrakopoulos, Α. Κοττόρου, A. Antonacopoulou, Ν. Παναγόπουλος, C. Scopa, M. Kalofonou, et al. Expression of immune system-related membrane receptors cd40, rank, baffr and ltβr is associated with clinical outcome of operated non-small-cell lung cancer patients, Journal of Clinical Medicine, vol. 8, no. 5, p. 741, 2019. https://doi.org/10.3390/jcm8050741
[2] C. Antoniades, C. Bakogiannis, D. Tousoulis, A. Antonopoulos, & C. Stefanadis. The cd40/cd40 ligand system, Journal of the American College of Cardiology, vol. 54, no. 8, p. 669-677, 2009. https://doi.org/10.1016/j.jacc.2009.03.076
[3] C. Qi, H. Ma, M. Fei, K. Qian, B. Shen, C. Wu, et al. A novel mutation in cd40 and its functional characterization, Human Mutation, vol. 30, no. 6, p. 985-994, 2009. https://doi.org/10.1002/humu.20967
[4] Z. Song, R. Jin, S. Yu, A. Nanda, D. Granger, & G. Li. Crucial role of cd40 signaling in vascular wall cells in neointimal formation and vascular remodeling after vascular interventions, Arteriosclerosis Thrombosis and Vascular Biology, vol. 32, no. 1, p. 50-64, 2012. https://doi.org/10.1161/atvbaha.111.238329
[5] L. Lu, W. Cook, L. Lin, & R. Noelle. Cd40 signaling through a newly identified tumor necrosis factor receptor-associated factor 2 (traf2) binding site, Journal of Biological Chemistry, vol. 278, no. 46, p. 45414-45418, 2003. https://doi.org/10.1074/jbc.m309601200
[6] L. Shorts, J. Weiss, J. Lee, R. Li, J. Subleski, T. Back, et al. Stimulation through cd40 on mouse and human renal cell carcinomas triggers cytokine production, leukocyte recruitment, and antitumor responses that can be independent of host cd40 expression, The Journal of Immunology, vol. 176, no. 11, p. 6543-6552, 2006. https://doi.org/10.4049/jimmunol.176.11.6543
[7] F. Dimitrakopoulos, A. Antonacopoulou, Α. Κοττόρου, M. Kalofonou, Ν. Παναγόπουλος, D. Dougenis, et al. Genetic variations of cd40 and ltβr genes are associated with increased susceptibility and clinical outcome of non-small-cell carcinoma patients, Frontiers in Oncology, vol. 11, 2021. https://doi.org/10.3389/fonc.2021.721577
[8] J. Portillo, Y. Corcino, Y. Miao, J. Tang, N. Sheibani, T. Kern, et al. Cd40 in retinal müller cells induces p2x7-dependent cytokine expression in macrophages/microglia in diabetic mice and development of early experimental diabetic retinopathy, Diabetes, vol. 66, no. 2, p. 483-493, 2016. https://doi.org/10.2337/db16-0051

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
Gene References into Functions
  1. CD40 is a key molecule for the upregulation of HIF-1alpha and PTEN underlying the severity of microangiopathy. PMID: 29549140
  2. the CD40 rs1883832 T allele acts as a risk factor for increased susceptibility to sepsis and may be involved in the process of sepsis through regulation of CD40 expression and plasma sCD40L levels. PMID: 29780830
  3. The 3'-UTR CD40LG (CA)n microsatellite is not a genetic marker for rheumatoid arthritis in western Mexican population; however, results suggest that it plays a role in the CD40LG mRNA expression. PMID: 28963582
  4. Herein, we present LOAd703, a designed adenovirus armed with trimerized CD40L and 4-1BBL that activates the CD40 and 4-1BB pathways, respectively PMID: 28536305
  5. Inducible activation of MyD88 and CD40 in CAR T cells with a small-molecule drug not only enhances their effector function, resulting in potent antitumor activity in preclinical solid tumors, but also enables their remote control post infusion. PMID: 28801306
  6. that the rs3765459 variant in CD40 gene is associated with susceptibility to neuromyelitis optica spectrum disorders. PMID: 27578014
  7. We disclosed the association of different CD40 SNPs with Graves disease and Hashimoto's Thyroiditis susceptibility in Chinese patients. This suggests that there might be several different susceptibility loci for autoimmune thyroid diseases (AITD) within CD40, each contributing a different effect in the onset and development of AITDs. PMID: 28742400
  8. CD40 gene rs4810485 and rs1883832 mutations investigated in Recurrent aphthous stomatitis patients. PMID: 27875792
  9. these data demonstrated that miR-145-5p may function as a cardiac-protective molecule in myocardial ischemic injury by ameliorating inflammation and apoptosis via negative regulation of CD40. PMID: 28281187
  10. rs4810485 G>T and rs1883832 C >T SNPs in the CD40 gene may be associated with disease susceptibility and severity in knee osteoarthritis in the Chinese Han population. PMID: 28320398
  11. miR-145 is involved in the anti-proliferation and anti-inflammation effects of aspirin on vascular smooth muscle cells by inhibiting the expression of CD40. PMID: 27412561
  12. selective knockdown of TNFR5 ameliorates glucolipotoxic induction of STAT1 expression and NF-kappaB activity. PMID: 27512950
  13. CD40 signaling in adipose tissue macrophages regulates major histocompatibility complex class II and CD86 expression to control the expansion of CD4(+) T cells. PMID: 26658005
  14. CD40 activation resulted in down-regulation of Thioredoxin (Trx)-1 to permit ASK1 activation and apoptosis. Although soluble receptor agonist alone could not induce death, combinatorial treatment incorporating soluble CD40 agonist and pharmacological inhibition of Trx-1 was functionally equivalent to the signal triggered by mCD40L. PMID: 27869172
  15. autologous CD4(+) T cells that are exposed to EVs from CD40/IL-4-stimulated CLL cells exhibit enhanced migration, immunological synapse signaling, and interactions with tumor cells. PMID: 27118451
  16. Cytokine expression upon simultaneous stimulation of TSHR and CD40 is greater than levels achieved with TSH or CD40L alone. Increased expression of CD40 by TSH is a potential mechanism for this process PMID: 27631497
  17. glatiramer acetate treatment also significantly reduced CD40-mediated P65 phosphorylation in RRMS patients, suggesting that reducing CD40-mediated p-P65 induction may be a general mechanism by which some current therapies modulate Multiple Sclerosis disease. PMID: 27798157
  18. Circulating sCD40L levels are increased in patients with cystic fibrosis and P. aeruginosa infection PMID: 28030642
  19. Our results support an important association of rs4810485 in CD40 gene and rs763361 in CD226 gene polymorphism, combined effect of rs4810485 and rs763361 with increased risk of systemic lupus erythematosus. PMID: 27722794
  20. CD40 activity in thyrocytes is prominently mediated via NF-kappaB. PMID: 27929668
  21. polymorphisms in the TP63 and CD40 genes are associated with lung cancer in a Chinese Han population PMID: 27063419
  22. Increased CD40 ligation and reduced B-cell receptor signalling leads to higher IL-10 production in B Cells from tolerant kidney transplant recipients. PMID: 27472092
  23. Essential hypertension patients showed increased expression of platelet CD40. PMID: 27090943
  24. CD40 monocyte is a novel inflammatory monocyte subset that could be used as a biomarker for chronic kidney disease severity. PMID: 27992360
  25. rs1535045 in CD40 gene is likely to be associated with Coronary Artery Disease (CAD) in the Chinese Han population; rs4239702(C)-rs1535045(T) haplotype is associated with CAD. the blood lipid level of patients with rs4239702-TT genotype was higher than other patients PMID: 27200368
  26. These results suggest that the CD40 SNPs rs1883832 and rs4810485 are not RA susceptibility markers in the western Mexican population. Further studies are needed to clarify their roles in CD40 mRNA expression. PMID: 27813548
  27. functional expression of CD40 on tumor cells might play an important role in tumor progression and lymph node metastasis in esophageal squamous cell carcinoma PMID: 27630283
  28. It is likely that the CD40/CD40L interactions and TNF alpha are effective against cervical carcinomas by repressing transcriptional activity of human papilloma virus-18 promoter. PMID: 27031714
  29. we demonstrate that antigen targeting to CD40 can evoke potent antigen-specific CD8(+) T cell responses in human CD40 transgenic mice PMID: 27077111
  30. Our findings suggest that the CD40 -1C/T SNP (rs1883832) is correlated with the susceptibility to lung cancer in Chinese, and the TT genotype may further increase the risk of lung cancer. PMID: 26823861
  31. CD40/CD40L system plays a role in regulating bone mineral density. PMID: 26545336
  32. There were significant differences in the gene and allele frequencies of CD40 gene rs1883832 C/T polymorphism between the patients with systemic lupus erythematosus and controls. sCD40 levels were increased in patients with SLE compared with controls PMID: 26289938
  33. Study provides preliminary evidence that CD40 may stimulate tumor growth by enabling immune evasion via MDSC recruitment and inhibition of T cell expansion. PMID: 26462153
  34. our results highlight new roles for CD40 and cysteine-238-mediated CD40 homodimers in cell biology and identify a potential new target for therapeutic strategies against CD40-associated chronic inflammatory diseases. PMID: 25977307
  35. meta-analyses confirm that the CD40 rs4810485 G/T polymorphism is associated with susceptibility to rheumatoid arthritis and systemic lupus erythematosus in Europeans. PMID: 25908480
  36. Platelet CD40 plays a crucial role in inflammation by stimulating leukocyte activation and recruitment and activation of endothelial cells, thereby promoting atherosclerosis. PMID: 26821950
  37. CD40 gene may play a role in the development of systemic lupus erythematosus in the Chinese population. PMID: 26474561
  38. Studies suggest that the CD40 antigen/CD154 antigen pathway represents a promising potential therapeutic target for the prevention of transplantation rejection. PMID: 26268734
  39. study shows a multiple sclerosis(MS)risk genotype-dependent reduction of CD40 cell-surface protein in B-lymphocytes and polarised dendritic cells; MS patients, regardless of genotype, express lower levels of CD40 cell-surface protein compared to controls in B lymphocytes; both genotype-dependent and independent downregulation of cell-surface CD40 is a feature of MS PMID: 26068105
  40. the ability of IL21 to modulate gene and miRNA expressions in CD40-activated Chronic Lymphocytic Leukemiacells, was studied. PMID: 26305332
  41. the direct CD40-CD40L interaction of breast tumor cells and activated T cells increases TGF-beta production and the differentiation of Th17 cells, which promotes the proliferation of breast cancer cells PMID: 25992978
  42. Differences in the expression levels of CD40 because of different genotypes of these two SNPs (rs4810485 and rs1883832) may take part in the development of skin lesions or genital ulcers in patients with Behcet disease. PMID: 25373542
  43. CD40 rs1883832C>T SNP decreases gene CD40 expression. PMID: 25600834
  44. The presence of CD40 on T cell membrane is crucial for induction of recombinase activity in patients with autoimmune type 1 diabetes mellitus. PMID: 22803080
  45. CD40 expression is significantly correlated with the TNM stage and the presence of distant metastasis in gastric carcinoma patients. PMID: 25665853
  46. CD40 signaling led to sustained ERK1/2 activation and up-regulation of Bcl-xL in BCR-primed HF1A3 germinal center B cells. PMID: 26054744
  47. subjects with the chronic hepatitis B (CHB) risk genotype TT of rs1883832 had the lowest plasma concentration of CD40, followed by subjects with CT and CC genotypes in both healthy controls and CHB patients PMID: 25802187
  48. On the surface of B lymphocytes, the CD40 expression levels in the individuals with TT genotype were significantly lower than those with CC and CT genotypes in either ASC group or healthy controls. PMID: 25547203
  49. A possible additive combined effect between CD40-1C>T and CTLA4+6230G>A polymorphisms in the development of Graves' disease. PMID: 25936345
  50. There is lack of association between CD40 polymorphisms and acute rejection in German liver transplant recipients. PMID: 25305459

Show More

Hide All

Involvement in disease
Immunodeficiency with hyper-IgM 3 (HIGM3)
Subcellular Location
[Isoform I]: Cell membrane; Single-pass type I membrane protein.; [Isoform II]: Secreted.
Tissue Specificity
B-cells and in primary carcinomas.
Database Links

HGNC: 11919

OMIM: 109535

KEGG: hsa:958

STRING: 9606.ENSP00000361359

UniGene: Hs.472860

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*