Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40),partial (Active)

In Stock
Code CSB-AP005181HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Human TNFSF5 in functional ELISA is less than 20 ug/ml.
Target Names CD40
Uniprot No. P25942
Research Area Immunology
Alternative Names AI326936; B cell associated molecule CD40; B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; Bp50; CD 40; CD40; CD40 antigen (TNF receptor superfamily member 5); CD40 antigen; CD40 molecule; CD40 molecule, TNF receptor superfamily member 5; CD40 protein; CD40 type II isoform; CD40L receptor; CDw40; GP39; HIGM1; IGM; IMD3; MGC9013; Nerve growth factor receptor related B lymphocyte activation molecule; OTTHUMP00000031699; OTTHUMP00000031700; p50; T-BAM; TBAM; TNF receptor superfamily member 5; TNFRSF5; TNR5_HUMAN; TRAP; Tumor necrosis factor receptor superfamily , member 5; Tumor necrosis factor receptor superfamily member 5; Tumor necrosis factor receptor superfamily member 5 precursor; Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 21-193aa
Complete Sequence EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Mol. Weight 46.3 kDa
Protein Length Extracellular Domain
Tag Info C-terminal FC-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
Gene References into Functions
  1. CD40 is a key molecule for the upregulation of HIF-1alpha and PTEN underlying the severity of microangiopathy. PMID: 29549140
  2. the CD40 rs1883832 T allele acts as a risk factor for increased susceptibility to sepsis and may be involved in the process of sepsis through regulation of CD40 expression and plasma sCD40L levels. PMID: 29780830
  3. The 3'-UTR CD40LG (CA)n microsatellite is not a genetic marker for rheumatoid arthritis in western Mexican population; however, results suggest that it plays a role in the CD40LG mRNA expression. PMID: 28963582
  4. Herein, we present LOAd703, a designed adenovirus armed with trimerized CD40L and 4-1BBL that activates the CD40 and 4-1BB pathways, respectively PMID: 28536305
  5. Inducible activation of MyD88 and CD40 in CAR T cells with a small-molecule drug not only enhances their effector function, resulting in potent antitumor activity in preclinical solid tumors, but also enables their remote control post infusion. PMID: 28801306
  6. that the rs3765459 variant in CD40 gene is associated with susceptibility to neuromyelitis optica spectrum disorders. PMID: 27578014
  7. We disclosed the association of different CD40 SNPs with Graves disease and Hashimoto's Thyroiditis susceptibility in Chinese patients. This suggests that there might be several different susceptibility loci for autoimmune thyroid diseases (AITD) within CD40, each contributing a different effect in the onset and development of AITDs. PMID: 28742400
  8. CD40 gene rs4810485 and rs1883832 mutations investigated in Recurrent aphthous stomatitis patients. PMID: 27875792
  9. these data demonstrated that miR-145-5p may function as a cardiac-protective molecule in myocardial ischemic injury by ameliorating inflammation and apoptosis via negative regulation of CD40. PMID: 28281187
  10. rs4810485 G>T and rs1883832 C >T SNPs in the CD40 gene may be associated with disease susceptibility and severity in knee osteoarthritis in the Chinese Han population. PMID: 28320398
  11. miR-145 is involved in the anti-proliferation and anti-inflammation effects of aspirin on vascular smooth muscle cells by inhibiting the expression of CD40. PMID: 27412561
  12. selective knockdown of TNFR5 ameliorates glucolipotoxic induction of STAT1 expression and NF-kappaB activity. PMID: 27512950
  13. CD40 signaling in adipose tissue macrophages regulates major histocompatibility complex class II and CD86 expression to control the expansion of CD4(+) T cells. PMID: 26658005
  14. CD40 activation resulted in down-regulation of Thioredoxin (Trx)-1 to permit ASK1 activation and apoptosis. Although soluble receptor agonist alone could not induce death, combinatorial treatment incorporating soluble CD40 agonist and pharmacological inhibition of Trx-1 was functionally equivalent to the signal triggered by mCD40L. PMID: 27869172
  15. autologous CD4(+) T cells that are exposed to EVs from CD40/IL-4-stimulated CLL cells exhibit enhanced migration, immunological synapse signaling, and interactions with tumor cells. PMID: 27118451
  16. Cytokine expression upon simultaneous stimulation of TSHR and CD40 is greater than levels achieved with TSH or CD40L alone. Increased expression of CD40 by TSH is a potential mechanism for this process PMID: 27631497
  17. glatiramer acetate treatment also significantly reduced CD40-mediated P65 phosphorylation in RRMS patients, suggesting that reducing CD40-mediated p-P65 induction may be a general mechanism by which some current therapies modulate Multiple Sclerosis disease. PMID: 27798157
  18. Circulating sCD40L levels are increased in patients with cystic fibrosis and P. aeruginosa infection PMID: 28030642
  19. Our results support an important association of rs4810485 in CD40 gene and rs763361 in CD226 gene polymorphism, combined effect of rs4810485 and rs763361 with increased risk of systemic lupus erythematosus. PMID: 27722794
  20. CD40 activity in thyrocytes is prominently mediated via NF-kappaB. PMID: 27929668
  21. polymorphisms in the TP63 and CD40 genes are associated with lung cancer in a Chinese Han population PMID: 27063419
  22. Increased CD40 ligation and reduced B-cell receptor signalling leads to higher IL-10 production in B Cells from tolerant kidney transplant recipients. PMID: 27472092
  23. Essential hypertension patients showed increased expression of platelet CD40. PMID: 27090943
  24. CD40 monocyte is a novel inflammatory monocyte subset that could be used as a biomarker for chronic kidney disease severity. PMID: 27992360
  25. rs1535045 in CD40 gene is likely to be associated with Coronary Artery Disease (CAD) in the Chinese Han population; rs4239702(C)-rs1535045(T) haplotype is associated with CAD. the blood lipid level of patients with rs4239702-TT genotype was higher than other patients PMID: 27200368
  26. These results suggest that the CD40 SNPs rs1883832 and rs4810485 are not RA susceptibility markers in the western Mexican population. Further studies are needed to clarify their roles in CD40 mRNA expression. PMID: 27813548
  27. functional expression of CD40 on tumor cells might play an important role in tumor progression and lymph node metastasis in esophageal squamous cell carcinoma PMID: 27630283
  28. It is likely that the CD40/CD40L interactions and TNF alpha are effective against cervical carcinomas by repressing transcriptional activity of human papilloma virus-18 promoter. PMID: 27031714
  29. we demonstrate that antigen targeting to CD40 can evoke potent antigen-specific CD8(+) T cell responses in human CD40 transgenic mice PMID: 27077111
  30. Our findings suggest that the CD40 -1C/T SNP (rs1883832) is correlated with the susceptibility to lung cancer in Chinese, and the TT genotype may further increase the risk of lung cancer. PMID: 26823861
  31. CD40/CD40L system plays a role in regulating bone mineral density. PMID: 26545336
  32. There were significant differences in the gene and allele frequencies of CD40 gene rs1883832 C/T polymorphism between the patients with systemic lupus erythematosus and controls. sCD40 levels were increased in patients with SLE compared with controls PMID: 26289938
  33. Study provides preliminary evidence that CD40 may stimulate tumor growth by enabling immune evasion via MDSC recruitment and inhibition of T cell expansion. PMID: 26462153
  34. our results highlight new roles for CD40 and cysteine-238-mediated CD40 homodimers in cell biology and identify a potential new target for therapeutic strategies against CD40-associated chronic inflammatory diseases. PMID: 25977307
  35. meta-analyses confirm that the CD40 rs4810485 G/T polymorphism is associated with susceptibility to rheumatoid arthritis and systemic lupus erythematosus in Europeans. PMID: 25908480
  36. Platelet CD40 plays a crucial role in inflammation by stimulating leukocyte activation and recruitment and activation of endothelial cells, thereby promoting atherosclerosis. PMID: 26821950
  37. CD40 gene may play a role in the development of systemic lupus erythematosus in the Chinese population. PMID: 26474561
  38. Studies suggest that the CD40 antigen/CD154 antigen pathway represents a promising potential therapeutic target for the prevention of transplantation rejection. PMID: 26268734
  39. study shows a multiple sclerosis(MS)risk genotype-dependent reduction of CD40 cell-surface protein in B-lymphocytes and polarised dendritic cells; MS patients, regardless of genotype, express lower levels of CD40 cell-surface protein compared to controls in B lymphocytes; both genotype-dependent and independent downregulation of cell-surface CD40 is a feature of MS PMID: 26068105
  40. the ability of IL21 to modulate gene and miRNA expressions in CD40-activated Chronic Lymphocytic Leukemiacells, was studied. PMID: 26305332
  41. the direct CD40-CD40L interaction of breast tumor cells and activated T cells increases TGF-beta production and the differentiation of Th17 cells, which promotes the proliferation of breast cancer cells PMID: 25992978
  42. Differences in the expression levels of CD40 because of different genotypes of these two SNPs (rs4810485 and rs1883832) may take part in the development of skin lesions or genital ulcers in patients with Behcet disease. PMID: 25373542
  43. CD40 rs1883832C>T SNP decreases gene CD40 expression. PMID: 25600834
  44. The presence of CD40 on T cell membrane is crucial for induction of recombinase activity in patients with autoimmune type 1 diabetes mellitus. PMID: 22803080
  45. CD40 expression is significantly correlated with the TNM stage and the presence of distant metastasis in gastric carcinoma patients. PMID: 25665853
  46. CD40 signaling led to sustained ERK1/2 activation and up-regulation of Bcl-xL in BCR-primed HF1A3 germinal center B cells. PMID: 26054744
  47. subjects with the chronic hepatitis B (CHB) risk genotype TT of rs1883832 had the lowest plasma concentration of CD40, followed by subjects with CT and CC genotypes in both healthy controls and CHB patients PMID: 25802187
  48. On the surface of B lymphocytes, the CD40 expression levels in the individuals with TT genotype were significantly lower than those with CC and CT genotypes in either ASC group or healthy controls. PMID: 25547203
  49. A possible additive combined effect between CD40-1C>T and CTLA4+6230G>A polymorphisms in the development of Graves' disease. PMID: 25936345
  50. There is lack of association between CD40 polymorphisms and acute rejection in German liver transplant recipients. PMID: 25305459
  51. protease activity of Per a 10 reduces CD40 expression on DCs. CD40 down-regulation leads to low NF-kappaB levels, thereby modulating DC-mediated immune responses. PMID: 25492061
  52. Data suggested that CD40 expression in dendritic cells is impaired in many cancer patients particularly those with metastatic disease. [REVIEW] PMID: 25163469
  53. CD4+ T cell-derived IL-21 and deprivation of CD40 signaling favor the in vivo development of granzyme B-expressing regulatory B cells in HIV patients. PMID: 25780036
  54. SNP rs1535045 may be associated with the development of Kawasaki disease in Han Chinese children. PMID: 25344184
  55. sCD40L levels were independently associated with angiographic severity of coronary artery disease in patients with acute coronary syndrome. PMID: 24931231
  56. Despite the fact that CD40-CD40L pathway plays a fundamental role in pathogenesis of autoimmune diseases, the gene-gene interactions between CD40 and CD40L associated with multiple sclerosis were not found in Polish multiple sclerosis patients. PMID: 24912008
  57. Interacting with liver cancer cells through the CD40/CD154 signaling pathway. PMID: 25301451
  58. The coordinated expression of CD40-CD40L was critical for production and autocrine IL-6 in XG1 cells. PMID: 25514317
  59. Positive CD40 mutant expression is associated with gastric cancer . PMID: 24885116
  60. the CD40 immune pathway is important in boosting cellular immunity within epithelial cells. PMID: 24945092
  61. preventing CD40-TRAF2,3 or CD40-TRAF6 interaction inhibits pro-inflammatory responses in human non-haematopoietic cells. PMID: 25051892
  62. CD40 expression in renal cell carcinoma is associated with tumor apoptosis, CD8-positive T-cell frequency and patient survival. PMID: 24801648
  63. The evidence of association of rs1883832 CD40 gene C allele with an overall increased risk of atherosclerosis. PMID: 24828072
  64. the T allele of the CD40 -1C/T polymorphism may be associated with post-stroke epilepsy susceptibility. PMID: 24657679
  65. These data indicate that type II Toxoplasma gondii GRA15II induction of CD40 promotes parasite immunity through the production of IL-12. PMID: 25024369
  66. Report a novel role for FAF1 in regulating CD40-induced NFkappaB activation via a negative feedback loop. PMID: 24810049
  67. Taken together, our results show that B cells from patients with chronic HBV infection can be activated by sCD40L and may function as antigen presenting cells and induce HBV-specific CTLs. PMID: 24866241
  68. Soluble CD40 ligand stimulates the pro-angiogenic function of peripheral blood angiogenic outgrowth cells via increased release of matrix metalloproteinase-9. PMID: 24358353
  69. CD40L/CD40 could inhibit human glioma cells. PMID: 23073798
  70. High levels of sCD40 and sCD40L were detected among patients with chronic HCV and HCV/ HIV-1 infection The high concentration of sCD40L correlates with CC rs12979860 genotype. PMID: 25004625
  71. Higher CD40 expression exists in expanding type tumors in gastric cancer. PMID: 19865524
  72. The upregulated levels of co-stimulators CD40/CD40L on B cells and T cells may play an important role in the immune pathogenesis of breast cancer. PMID: 23456134
  73. Lack of CD40-CD40L interaction leads to defective T-cell priming and interferon-gamma secretion, which could contribute to susceptibility to opportunistic infections in 11 patients with hyper-IgM syndrome. PMID: 24122029
  74. CD40 overexpression was correlated with low recurrence of the tumor, implying that CD40 plays an important role in the antitumor response against sacral chordomas and in the inhibition of tumor recurrence. PMID: 24107910
  75. CD40 expression on pancreatic cancer cells and peritumoral lymphocytic reaction may serve as prognostic markers. PMID: 24719952
  76. describe the unfavorable prognostic influence of dense CD40 expression by bone marrow stromal cells in splenic marginal zone lymphoma PMID: 24452203
  77. T8-cell-expressed CD40 plays a role in the augmentation of donor-reactive T8 cell responses after transplantation. CD40 expressed on T8 cells must be inhibited to allow conversion of CDT4 cells into induced Treg cells. PMID: 23858029
  78. cooperative interactions between fibrocytes and Th17 cells play an important role via CD40- and IL-17A/F-mediated signaling for collagen and proangiogenic factor production, which may lead to extracellular matrix deposition and neovascularization PMID: 23400328
  79. CD154 is released from T-cells by ADAM10 and ADAM17 upon CD40 ligation PMID: 24189063
  80. CD40 -1C/T polymorphism may interfere cerebral infarction susceptibility. PMID: 23669336
  81. association of SNPs of CD40 gene with multiple sclerosis PMID: 23613777
  82. For the polymorphism in the CD40 gene, there were no statistically significant differences in the allele and genotype frequencies between malaria and non-malaria individuals. PMID: 23604864
  83. We identify the Fn14-TWEAK system as a potential novel regulator of CD40-related cellular functions PMID: 23918987
  84. CD40 -1C/T polymorphism might contribute to the susceptibility to ischemic stroke in the Chinese population, and might be associated with history of previous stroke. PMID: 23954880
  85. Activation of CD40 by recombinant soluble CD40 ligand readily induces NF-kappaB activation in cancer cells. PMID: 23751348
  86. SDF-1alpha acts through CXCR4 to induce ovarian cancer cell migration, which could be facilitated by CD40 activation. PMID: 23924922
  87. The correlation between T stage of gastric cancer and the higher expression of CD40, VEGF, AKT, and PI3K, along with lower S100 expression in DC, may provide insights into future targets for more effective immunotherapy for cancer. PMID: 23429328
  88. Our data revealed that downregulation of CD32B on B cells from patients with rheumatoid arthritis is mediated by CD40-CD40L interactions PMID: 23686494
  89. These studies revealed that CD40 induces toxoplasmacidal activity in various nonhematopoietic cells dependent on proteins of the autophagy machinery. PMID: 23509150
  90. Overview on the role of CD40-CD40L interactions in the pathogenesis of T2DM with a special focus on pancreatic, adipose tissue and vascular inflammation. [Review] PMID: 22965071
  91. CD40 plays an important role in the tumor immunity of colorectal cancer. PMID: 22687258
  92. CD40 gene's polymorphism is associated with multiple sclerosis among residents of the Russian Federation. PMID: 23528588
  93. An C allele of rs6074022 polymorphism (CD40) was associated with a higher rate of MS progression. PMID: 23528589
  94. the CD40 T variant might be negatively associated with some clinical disease manifestations in patients with systemic lupus erythematosis. PMID: 23257401
  95. CD40 self-assembly modulates signaling, possibly by maintaining the receptor in a quiescent state. PMID: 23463508
  96. CD40 C/T-1 polymorphism plays different roles in Graves disease and Hashimoto's thyroiditis. PMID: 22863718
  97. CD40 and FCRL3 gene polymorphisms were associated with autoimmune hyperthyroidism intractability. PMID: 22706687
  98. The CD40 and CD40-L expressions on monocytes and T cells, respectively, decrease as the head and neck squamous cell carcinoma (HNSCC) patients progress from stage-I through stage-IV. PMID: 23000501
  99. CD40 results in slower disease progression and scrapie strain-specific differences in incubation periods. PMID: 23419881
  100. Our results do not suggest an important role of CD40 and CD40LG gene polymorphisms in the susceptibility to or clinical expression of systemic sclerosis PMID: 22731751

Show More

Hide All

Involvement in disease Immunodeficiency with hyper-IgM 3 (HIGM3)
Subcellular Location Isoform I: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform II: Secreted
Tissue Specificity B-cells and in primary carcinomas.
Database Links

HGNC: 11919

OMIM: 109535

KEGG: hsa:958

STRING: 9606.ENSP00000361359

UniGene: Hs.472860

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1