Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

In Stock
Code CSB-AP005141HU
Abbreviation Recombinant Human TNFRSF9 protein, partial (Active)
MSDS
Size $116
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Loaded Human 4-1BB-His on HIS1K Biosensor, can bind Anti-Human CD137 mAb-Fc with an affinity constant of 25.5 nM as determined in BLI assay.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
4 1BB; 4 1BB ligand receptor; 4-1BB ligand receptor; 4-1BB Ligand Receptor T Cell; 4-1BB, mouse, homolog of; Antigen 4-1BB Homolog; CD 137; CD137; CD137 antigen; CDw137; HLDA VI; Homolog of mouse 4 1BB; ILA; induced by lymphocyte activation (ILA); Induced by lymphocyte activation; Interleukin activated receptor homolog of mouse Ly63; Ly63, mouse, homolog of; MGC2172; OTTHUMP00000044294; Receptor protein 4 1BB; T cell antigen 4 1BB homolog; T cell antigen ILA; T-cell antigen 4-1BB homolog; T-cell antigen ILA; TNF receptor superfamily member 9; TNFRSF9; TNR9_HUMAN; Tumor necrosis factor receptor superfamily member 9
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-186aa
Complete Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Mol. Weight
18.1 kDa
Protein Length
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TNFRSF9 (4-1BB) is a costimulatory immune checkpoint receptor whose engagement on T cells amplifies anti-tumor immunity, making it a high-priority target in immuno-oncology drug development. This recombinant human 4-1BB extracellular domain (aa 24–186), expressed in mammalian cells to preserve native glycosylation and disulfide-mediated folding, demonstrates confirmed binding to an anti-CD137 mAb-Fc with a KD of 25.5 nM by BLI—validating its conformational integrity for receptor-ligand interaction assays, therapeutic antibody epitope mapping, and competitive blocking antibody screening. The C-terminal His tag enables oriented loading on biosensor tips, supporting direct affinity characterization by BLI or SPR and use as a positive control in binding assays. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein satisfies the quality criteria typical for immune checkpoint research and small-molecule or biologic inhibitor screening campaigns.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Gene References into Functions
  1. 3 SNPs (rs161827, rs161818, and rs161810) of the CD137 gene and their association with ischemic stroke were studied in a northern Chinese Han population. rs161827 was significantly different between patients with and without diabetes and the controls. rs161818 and rs161810 differed significantly between patients without diabetes and the controls. All 3 were statistically significant in the combination stroke group. PMID: 28755037
  2. Herein, we present LOAd703, a designed adenovirus armed with trimerized CD40L and 4-1BBL that activates the CD40 and 4-1BB pathways, respectively PMID: 28536305
  3. Tonic 4-1BB costimulation in chimeric antigen receptors impedes T cell survival and is vector-dependent. PMID: 28978471
  4. Cetuximab-mediated NK-cell expression of CD137 on tumor-infiltrating lymphocytes is dependent on FcgammaRIIIa polymorphism. In neoadjuvant cetuximab-treated patients with head and neck cancer, upregulation of CD137 by intratumoral, cetuximab-activated NK cells correlated with FcgammaRIIIa V/F polymorphism and predicted clinical response. PMID: 27496866
  5. In this study we systematically evaluated a series of CAR constructs targeting glypican-3 (GPC3), which is selectively expressed on several solid tumors. We compared GPC3-specific CARs that encoded CD3zeta (Gz) alone or with costimulatory domains derived from CD28 (G28z), 4-1BB (GBBz), or CD28 and 4-1BB (G28BBz). PMID: 27530312
  6. 4-1BB and 4-1BBL qualify as markers for prediction of patients' course and represent a valuable screening target for patients with acute myeloid leukemia at initial diagnosis. PMID: 27388616
  7. the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID: 27430526
  8. Egr2-driven cell surface proteins LAG-3 and 4-1BB can identify dysfunctional tumor antigen-specific CD8(+) TIL. PMID: 28115575
  9. Findings indicate that CD137 antigen is a useful marker that can be used for identifying Mycobacterium tuberculosis (Mtb)-reactive CD4(+) T cells (Mtb-reactive CD4(+) T cells) by flow cytometry. PMID: 28218958
  10. Anti-4-1BB single chain variable fragments enhanced surface CD69 expression and interleukin-2 production in stimulated CCRF-CEM cells which confirmed the agonistic effect of the selected single chain variable fragments. The data from this study have provided a rationale for further experiments involving the biological functions of anti-4-1BB single chain variable fragments in future studies. PMID: 28347235
  11. Studies suggest that adoptive T cell therapy and CD137 antigen offer much opportunity to raise the efficacy of current cancer immunotherapies. PMID: 26970765
  12. in complex with T cell receptor, promotes memory T cells, cell respiration, fatty acid oxidation and mitochondrial biogenesis PMID: 26885860
  13. These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication. PMID: 26467721
  14. Our findings provide a novel, TNFRSF9-positive, reactive astrocytic phenotype in human gliomas PMID: 24606203
  15. Human genetic evidence for involvement of CD137 in atherosclerosis PMID: 25032953
  16. As a result of becoming activated, transferred human T lymphocytes express the inducible surface antigens hPD-1 and hCD137 on their plasma membrane. PMID: 26113085
  17. Our results provide biological explanations for the antitumor effects of CD19 CARs and for the observations that CD19 CAR T cells incorporating the 4-1BB costimulatory domain are more persistent than those incorporating CD28 in clinical trials. PMID: 25939063
  18. upregulation of CD137 expression through LMP1 by EBV promotes cell survival in T or NK cells PMID: 25409517
  19. Based on CD137 or CD154 expression. PMID: 25367298
  20. High expression of CD137 is associated with type 1 diabetes. PMID: 24797972
  21. DENV C disrupts Daxx and NF-kappaB interaction to induce CD137-mediated apoptosis during DENV infection PMID: 25019989
  22. action of agonist anti-4-1BB in suppressing autoimmune and allergic inflammation was completely dependent on Galectin-9 (Gal-9). Gal-9 directly bound to 4-1BB, in a site distinct from the binding site of antibodies and the natural ligand of 4-1BB PMID: 24958847
  23. A role for the TNFR-family member CD137 in the immunobiology of human cancer where it is preferentially expressed on tumor-reactive subset of tumor-infiltrating lymphocytes. PMID: 24045181
  24. monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID: 24639347
  25. findings show that immunohistochemistry for CD137L is capable of reliably distinguishing small B-cell lymphomas from reactive lymphoid aggregates PMID: 24746207
  26. Dengue virus induces CD137 signaling to enhance apoptosis by increasing TNF-alpha production via activation of p38 MAPK. PMID: 23557259
  27. this is the first study to indicate that this member of the TNF superfamily, CD137, is modulated by SAHA treatment in breast cancer cells PMID: 22797667
  28. The CD137 multi-parameter flow cytometry fast assay allows for phenotypic and functional determination of alloreactive precursor frequencies of both CD4+ and CD8+ T cells with high sensitivity and specificity. PMID: 23750604
  29. Co-stimulation through 4-1BB/CD137 improves the expansion and function of CD8(+) melanoma tumor-infiltrating lymphocytes for adoptive T-cell therapy. PMID: 23560068
  30. Taken together, these data provide evidence that the 4-1BB signal is an important regulator of gammadelta T cells PMID: 23640752
  31. the mechanisms that account for the effect of CD137 signaling on TNF-alpha production were based on a decrease of TNF-alpha production by antigen presenting cell (APC) and, perhaps, on the increase in APC apoptosis. PMID: 23437083
  32. Our results reveal a new regulatory mechanism for CD137L expression that mediates immune escape by HRS cells, and they identify CD137 as a candidate target for immunotherapy of Hodgkin PMID: 23204227
  33. Head and neck cancer patients have decreased levels of alternative co-stimulatory receptors OX40 and 4-1BB. PMID: 22204816
  34. 4-1BB (CD137), together with CD103, marks mesenteric lymph node dendritic cells (DC) with the highest level of retinal dehydrogenase (RALDH) activity, and ligation of 4-1BB maintains RALDH expression in these gut DC. PMID: 22896640
  35. CD137 protein is expressed by a select group of hematolymphoid tumors, including classical Hodgkin lymphoma, T-cell and NK/T-cell lymphomas, and follicular dendritic cells neoplasms. PMID: 22901750
  36. treatment with CD137 agonistic antibody induces CCL21 expression and DC accumulation close to lymphatic vessels. Collectively, our results demonstrate that the inflammatory function of lymphatic vessels can be regulated by CD137. PMID: 22593548
  37. CD137:CD137L interactions regulate the innate and adaptive immune response of the host against M. tuberculosis PMID: 21747409
  38. significantly positive correlation between CD137 expression and complex coronary stenosis morphology PMID: 21396356
  39. Data indicate that 4-1BBL mediates NK-cell immunosubversion in CLL, and thus might contribute to the reportedly compromised efficacy of Rituximab to induce NK-cell reactivity in the disease. PMID: 22144129
  40. CD137 activity is directly proportional to colorectal cancer stage. Surgical resection of the tumor results in increased CD134 and CD137 expression PMID: 22343199
  41. We show that the inflammatory and cytotoxic function of CD4(+)CD28(null) T cells can be inhibited by blocking OX40 and 4-1BB costimulatory receptors. PMID: 22282196
  42. The sCD137 levels correlate with the probability of complications and lethality. The association of sCD137, a product of activated T cells, with the severity of acute pancreatitis suggests that T cells contribute to the pathogenesis of acute pancreatitis. PMID: 21963611
  43. CD137 has a role in breast cancer and its specific antibody can be used to enhance trastuzumab efficacy PMID: 22326955
  44. conditioned medium from Lewis Lung Carcinoma cells caused significant upregulation of 4-1BB in mast cells PMID: 22343053
  45. Data indicate that ex4-1BBL augments 4-1BB expression not only on the primed T cell, but also on DC. PMID: 21745658
  46. The measurement of a single gene expressed by tumor cells (LMO2) and a single gene expressed by the immune microenvironment (TNFRSF9) powerfully predicts overall survival in patients with diffuse large B-cell lymphoma. PMID: 21670469
  47. This work is the first to demonstrate the contribution of CD137 signaling to DENV-mediated apoptosis. PMID: 21669186
  48. CD137 ligand can also be expressed as a transmembrane protein on the cell surface and transmit signals into the cells on which it is expressed (reverse signaling). PMID: 20643812
  49. Results suggest with a two-step model of M cell differentiation, with initial CD137-independent commitment to the M cell lineage followed by CD137-CD137L interaction of M cells with CD137-activated B cells or dendritic cells for functional maturation. PMID: 20616340
  50. Data support a role for CD137 in the recruitment of monocytes to inflammatory tissues. PMID: 20347151

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on the surface of activated T-cells.
Database Links

HGNC: 11924

OMIM: 602250

KEGG: hsa:3604

STRING: 9606.ENSP00000366729

UniGene: Hs.738942

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*