Recombinant Human Interleukin-7 (IL7) (Active) (GMP)

Unavailable
Code CSB-AP005851HU
MSDS
Size US$223
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
> 98 % by SDS-PAGE and HPLC analyses.
Endotoxin
Less than 0.01 EU/μg of rHuIL-7 GMP as determined by LAL method.
Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine 2E8 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg.
Target Names
IL7
Uniprot No.
Research Area
Immunology
Alternative Names
IL7; Interleukin-7; IL-7
Species
Homo sapiens (Human)
Source
E.Coli
Expression Region
26-177aa
Complete Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Mol. Weight
17.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Gene References into Functions
  1. Human IL-7 binds more strongly to stretched than to relaxed Fibronectin. PMID: 28845674
  2. Downregulation of IL-7 and T follicular helper cells (Tfh) might contribute to viral persistence in hepatitis C virus (HCV)infection. The in vitro study revealed an immunopotentiator of IL-7 in chronic HCV infection, which manifested as IL-7-regulated HCV-specific and nonspecific activated Tfh cells. PMID: 29672235
  3. These data indicate the involvement of IL-7 into a direct upregulation of growth and functional activity of human T cells in the absence of antigenic stimulus and the relative scarcity of costimulatory effects. PMID: 30193429
  4. these findings add further evidence that IL-7 is a key regulatory factor that may tune the balance between functionally different T-cell subsets following haematopoietic stem cell transplantation PMID: 29033080
  5. The constitutively signaling C7R system developed here delivers potent IL7 stimulation to CAR T cells, increasing their persistence and antitumor activity against multiple preclinical tumor models, supporting its clinical development PMID: 28830878
  6. we demonstrated that Imatinib mesylate (IM)impaired T cell survival through the inhibition of IL-7 and STAT5-p but not TCR signaling which remained unaffected during IM therapy. Thus, off-target inhibitory effects of IM on IL-7 and STAT5-p explain how T cell lymphopenia occurs in patients treated with IM. PMID: 28387753
  7. In this study, authors compared the concentrations of IL-15 and IL-7 in the plasma of MDS patients (n = 20) compared with that in the plasma of healthy controls (n = 20). PMID: 27036031
  8. Data strongly implicate IL-7 in the thymus-independent long-term survival of functional naive-Tregs. PMID: 26910841
  9. the critical role played by IL-7 and IL-15 in T cell homeostasis and how these cytokines could be used to improve immune reconstitution after allogeneic SCT. PMID: 26795458
  10. IL-7/IL-7R signaling pathway plays a possible role in recurrent pregnancy loss by upregulating Th17 immunity while downregulating Treg immunity. PMID: 27767237
  11. IL-7 inhibits the osteogenic differentiation of Periodontal ligament stem cells probably via inactivation of mitogen-activated protein kinase (MAPK) signaling pathway. PMID: 27579861
  12. this study shows that IL-7 restores T Lymphocyte immunometabolic failure in septic shock patients through mTOR activation PMID: 28724580
  13. In CRC, IL-7 was higher in patients with lymph node and distant metastases and with tumors located in right colon. In adenomas, IL-7 elevation was associated exclusively with villous growth pattern, while in IBD, circulating IL-7 reflected clinical activity of Crohn's disease and ulcerative colitis. PMID: 27866242
  14. Tuberculosis patients had lower soluble IL-7R and higher IL-7 plasma concentrations as compared to healthy contacts. PMID: 28582466
  15. CD56(bright) NK IL-7Ralpha expression negatively associates with HCV level, and IL-7-induced NK function is impaired during HCV and HIV infections PMID: 28400540
  16. IL-7 has a role inducing epitope masking of gammac protein in IL-7 receptor signaling complex PMID: 28127156
  17. Therefore, generalized CD8+ T-cell impairment in HCV infection is characterized, in part, by impaired IL-7-mediated signalling and survival, independent of CD127 expression. This impairment is more pronounced in the liver and may be associated with an increased potential for apoptosis. This generalized CD8+ T-cell impairment represents an important immune dysfunction in chronic HCV infection that may alter patient health. PMID: 27315061
  18. These results reveal a novel role of IL-7 and IL-15 in maintaining human T cell function, provide an explanation for T cell dysfunction in humanized mice, and have significant implications for in vitro studies with human T cells. PMID: 27855183
  19. The results show that SNPs in IL7 caused a significant association in this OA Chinese Han population. PMID: 27235388
  20. IL-7 is capable of enhancing functional T cell activity without causing significant functional inbalance between various T cell subsets. PMID: 28396296
  21. In summary, our study demonstrates that IL-7/IL-7R axis promotes the invasion and migration of prostate cancer cells, through activation of AKT/NF-kappaB pathway and upregulation of MMP-3 and MMP-7 expression PMID: 27611862
  22. review of role of IL-7 in immunity and its role in the pathogenesis of neoplasia [review] PMID: 28314253
  23. Indian patients with primary Sjogren's syndrome have higher salivary sL-selectin and IL-7 levels than healthy controls PMID: 27620619
  24. increased IL-7 was secreted by mesenchymal stem cells (MSC) in the bone marrow, which may protect leukemic cells from apoptosis induced by imatinib through JAK1/STAT5 signaling pathway PMID: 27272942
  25. The results from this study suggested for the first time that miR-181c was able to negatively regulate the production of proinflammatory cytokines IL-7 and IL-17 in myasthenia gravis patients. PMID: 25962782
  26. Increase in serum IL-7 is associated with adenoma. PMID: 25793917
  27. provides negative feedback on its own signaling in T cells via endocytosis and degradation of its receptor, CD127 PMID: 26272555
  28. Observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients. PMID: 26615570
  29. The observations suggest that IL-7 may play a role in the pathogenesis of Graves' disease and may be associated with its clinical activity. PMID: 26113403
  30. IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes. PMID: 26177551
  31. IL7 was expressed primarily in the infundibulum and suprabulb of the hair follicle. IL7 expression was increased in cutaneous T-cell lymphoma. PMID: 26479922
  32. this study identified that IL-7, as well as the Akt/ mTOR signaling pathway, effectively modulates human Double-Negative T Cell- mediated suppression of allogeneic T cell responses. PMID: 26324773
  33. IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients. PMID: 25933188
  34. In view of the important role IL-7 plays in lymphocyte proliferation, homeostasis and survival, down regulation of CD127 by Tat likely plays a central role in immune dysregulation and CD4 T-cell decline PMID: 25333710
  35. decreased IL-7 in peripheral blood, maybe, is a consequence of the negative feedback of the pro-inflammatory function in ITP patients. PMID: 24750122
  36. Septic patients showed the lowest levels of IL-7. Patients with severe sepsis reached levels of IL-7 higher than those observed in the groups of uncomplicated sepsis and septic shock. PMID: 25169828
  37. These observations provide evidence of a novel mechanism that enables cells to optimally use IL-7. PMID: 25870237
  38. blocking IL-7 in hMSCs-lymphocytes co-cultures increased lymphocytes apoptosis and we also have demonstrated that hMSCs are able to produce this interleukin PMID: 25184791
  39. The present data indicate that high plasma levels of IL-7 in the early post-transplant period are predictive for slow T cell reconstitution, increased risk of acute graft-versus-host disease and increased mortality following haematopoietic stem cell transplantation. PMID: 25263171
  40. IL-7 elevates miR-124 to decrease the expression of splicing regulator PTB and represses CD95 mRNA splicing. PMID: 25411246
  41. These results strongly suggest that IL-7/IL-7R prevents apoptosis by upregulating the expression of bcl-2 and by downregulating the expression of bax PMID: 24695377
  42. These data suggest that increased IFN-alpha activity may promote the loss of T cells by accelerating cell turnover and activation-induced cell death while decreasing the renewal of T cells by inhibiting the proliferative effect of IL-7. PMID: 25063872
  43. Diminished T-cell responsiveness to IL-7. PMID: 24585897
  44. Low-level transient antigenic stimuli during cART were not associated with changes in the thymic function or the IL-7/CD127 system. PMID: 24820104
  45. IL-7 can have a significant impact in sustaining expansion and persistence of adoptively chimeric antigen receptor-redirected cytotoxic T lymphocytes. PMID: 24097874
  46. IL-23 does not induce IL-7 expression in microglia and astrocytes. PMID: 24224652
  47. Changes of IL-7 expression in different phases of Graves ophthalmopathy (GO) suggested that IL-7 may play an important role in the pathogenesis of GO. PMID: 23188693
  48. These results suggest that ineffective responses to IL-7 could impair the transition to memory cells of naive CD4(+) T lymphocytes recognizing self-peptides in the setting of strong costimulation. PMID: 23454917
  49. our data point toward an unexpected new role for IL-7 as a potential autocrine mediator of lymphatic drainage PMID: 23963040
  50. our data show that IL-7 negatively regulates Tregs PMID: 23966629

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-7/IL-9 family
Database Links

HGNC: 6023

OMIM: 146660

KEGG: hsa:3574

STRING: 9606.ENSP00000263851

UniGene: Hs.591873

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*