Recombinant Human Interleukin-7(IL7),partial (Active) (GMP)


In Stock
GMP
Code CSB-AP005851HU
Product Type Interleukin
Size $6883Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P13232
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Alias IL-7
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine 2E8 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg.
Purity > 98 % by SDS-PAGE and HPLC analyses.
Endotoxin Less than 0.01 EU/μg of rHuIL-7 GMP as determined by LAL method.
Sequence DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Research Area Immunology
Source E.Coli
Gene Names IL7
Expression Region 26-177aa
Tag Info Tag-Free
Mol. Weight 17.4 kDa
Protein Description Partial
PubMed ID 2643102; 2329282; 16421571; 15489334; 9407080; 8862549; 10850801; 19141282
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Subcellular Location Secreted
Protein Families IL-7/IL-9 family
Database Links

HGNC: 6023

OMIM: 146660

KEGG: hsa:3574

STRING: 9606.ENSP00000263851

UniGene: Hs.591873

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Related Products

IL7 Antibodies

IL7 Antibodies for Homo sapiens (Human)

IL7 Proteins

IL7 Proteins for Homo sapiens (Human)

IL7 ELISA Kit

IL7 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.