Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 μg/mL can bind Anti-IL17A recombinant antibody (CSB-RA624104MA1HU), the EC50 is 1.818-2.170 ng/mL.
Alternative Names
(IL-17)(IL-17A)(Cytotoxic T-lymphocyte-associated antigen 8)(CTLA-8)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
24-155aa(T26A)
Target Protein Sequence
GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
CUSABIO's product CSB-BP624104HU(M) is a recombinant human IL17A protein generated in the Baculovirus by the co-expression of human IL17A 24-155aa (T26A) with an N-terminal 6xHis-tag. The DNA fragment coding for the human IL17A 24-155aa has a mutation Thr 26 Ala. Its purity is greater than 95% determined by SDS-PAGE. The endotoxin of this protein is less than 1.0 EU/µg protein (measured by the LAL method). This recombinant human IL17A (T26A) protein has been validated to be biologically active through its interaction with an anti-IL17A recombinant antibody (CSB-RA624104MA1HU). The EC50 for this effect is 1.818-2.170 ng/mL.
IL17A can be produced by multiple cells but mainly by Th17. IL17A mainly mediates neutrophil-induced inflammatory response and is closely related to rheumatoid arthritis, asthma, multiple sclerosis, psoriasis, COPD, pulmonary fibrosis, hepatocirrhosis, and graft rejection. IL17A regulates the activities of NF-κB and MAPKs. It can stimulate the expression of IL6 and PTGS2/COX-2 and enhance the production of nitric oxide (NO). IL-17 has a powerful role in recruiting and activating neutrophils. In vitro and in vivo studies have found that IL17A can promote the release of cytokines such as IL-8 and G-CSF from airway epithelial cells or fibroblasts, and indirectly activate neutrophil activity after activating elastin and myeloid peroxidase. Further studies revealed that IL17A recruits neutrophils by inducing neutrophil mobility factors such as IL-6 and MIP-2.