Recombinant Human Interleukin-17A(IL17A)

In Stock
Code CSB-AP004341HU
Product Type Interleukin
Size $124Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q16552
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 500 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Research Area Immunology
Source Mammalian cell
Gene Names IL17A
Expression Region 24-155aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 20.5 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ligand for IL17RA and IL17RC
Subcellular Location Secreted
Protein Families IL-17 family
Tissue Specificity Restricted to activated memory T-cells.
Database Links

HGNC: 5981

OMIM: 603149

KEGG: hsa:3605

STRING: 9606.ENSP00000344192

UniGene: Hs.41724

Pathway IL-17 signaling pathway
Th17 cell differentiation

Related Products

IL17A Antibodies

IL17A Antibodies for Human

IL17A Proteins

IL17A Proteins for Homo sapiens (Human)

IL17A ELISA Kit

IL17A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.