Code | CSB-AP004341HU |
Size |
$124Purchase it in Cusabio online store (only available for customers from the US) |
Image |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 500 ng/ml. |
Target Names | IL17A |
Uniprot No. | Q16552 |
Research Area | Immunology |
Alternative Names | Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17 |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 24-155aa |
Complete Sequence | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Mol. Weight | 20.5 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info | C-terminal 6xHis-tagged |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Ligand for IL17RA and IL17RC |
Subcellular Location | Secreted |
Protein Families | IL-17 family |
Tissue Specificity | Restricted to activated memory T-cells. |
Database Links |
HGNC: 5981 OMIM: 603149 KEGG: hsa:3605 STRING: 9606.ENSP00000344192 UniGene: Hs.41724 |
Recombinant Human Heterogeneous nuclear ribonucleoprotein M(HNRNPM)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Glucose-6-phosphate isomerase(Gpi)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Adenine phosphoribosyltransferase(APRT)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Transcription factor E2F6(E2F6)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human DNA repair protein RAD51 homolog 4(RAD51D)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide