Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004341HU |
| Product Type | Interleukin |
| Size |
$124Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | Q16552 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alias | Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17 |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 500 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | IL17A |
| Expression Region | 24-155aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 20.5 kDa |
| Protein Description | Full Length of Mature Protein |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Ligand for IL17RA and IL17RC |
| Subcellular Location | Secreted |
| Protein Families | IL-17 family |
| Tissue Specificity | Restricted to activated memory T-cells. |
| Database Links |
HGNC: 5981 OMIM: 603149 KEGG: hsa:3605 STRING: 9606.ENSP00000344192 UniGene: Hs.41724 |
| Pathway |
IL-17 signaling pathway
Th17 cell differentiation |
IL17A Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA011597GA01HU | IL17A Antibody | Human | ELISA,IHC |
| CSB-PA06659A0Rb | IL17A Antibody | Human | ELISA, IHC, IF |
| CSB-PA06659B0Rb | IL17A Antibody, HRP conjugated | Human | ELISA |
| CSB-PA06659C0Rb | IL17A Antibody, FITC conjugated | Human | ELISA |
| CSB-PA06659D0Rb | IL17A Antibody, Biotin conjugated | Human | ELISA |
IL17A Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-AP004331HU | Recombinant Human Interleukin-17A(IL17A) | E.coli |
| CSB-AP004701HU | Recombinant Human Interleukin-17A & Interleukin-17F(IL17A & IL17F) | Mammalian cell |
| CSB-YP624104HU CSB-EP624104HU CSB-BP624104HU CSB-MP624104HU |
Recombinant Human Interleukin-17A(IL17A) | Yeast E.coli Baculovirus Mammalian cell |
| CSB-AP001851HU | Recombinant Human Interleukin-17A protein(IL17A) (Active) | E.coli |
IL17A ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E12819h | Human Interleukin 17A (IL-17A/IL-17) ELISA Kit | serum, urine, cell culture supernates, tissue homogenates | 1.56 pg/mL |
Recombinant Human Tyrosine-protein kinase Lck(LCK)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Androgen receptor(AR) ,partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Methylmalonyl-CoA mutase, mitochondrial(MMUT)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human DNA-(apurinic or apyrimidinic site) lyase(APEX1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Proteasome subunit beta type-8(PSMB8)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Proteasome subunit beta type-10(PSMB10)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Transcription activator BRG1(SMARCA4),partial
Express system: Yeast
Species: Homo sapiens (Human)
-AC.jpg)
Recombinant Human Aquaporin-1(AQP1)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
