Recombinant Human GTPase HRas (HRAS), partial, Biotinylated

Code CSB-EP010726HU-B
Abbreviation Recombinant Human HRAS protein, partial, Biotinylated
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
H-Ras-1;Ha-Ras;Transforming protein p21;c-H-ras;p21ras
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-186aa
Target Protein Sequence
TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.6 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the activation of Ras protein signal transduction. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Gene References into Functions
  1. results demonstrate that adenomyoepitheliomas are genetically heterogeneous, and qualify mutations in HRAS, a gene whose mutations are vanishingly rare in common-type breast cancers, as likely drivers of ER-negative adenomyoepitheliomas PMID: 29739933
  2. Plasma membrane polyphosphoinositides depletion caused rapid translocation of K-Ras4B but not H-Ras from the plasma membrane to the Golgi. PMID: 28939768
  3. Data show that an indispensable beta-subunit of the voltage-gated Ca(2+) channel Cav1.2 interaction with H-Ras is independently of Ca(2+) flux, suggesting the regulatory role of beta2 in transcriptional activation via the ERK/CREB pathway. PMID: 30150369
  4. This study demonstrated that Oligodendrocyte RasG12V expressed in its endogenous locus disrupts myelin structure through increased MAPK, nitric oxide, and notch signaling. PMID: 28856719
  5. Data indicate dynamic of H-Ras functional cycle as controlled by son of sevenless homolog 1 (Sos). PMID: 27412770
  6. Our data support the idea that a variable range of dysregulated HRAS-dependent signalling dynamics, rather than static activation of HRAS-dependent signal flow, may underlie the phenotypic variability in CS. PMID: 28139825
  7. AF6 employs a non-canonical, evolutionarily conserved alpha-helix to bind RAS, unique to AF6 and the classical RASSF effectors. PMID: 29062045
  8. Case Report: somatic HRAS mutation in pigmented trichoblastoma developed in a sebaceous nevus. PMID: 28554764
  9. our identification of the novel interaction between Aurora A and H-Ras as a mechanism by which Aurora A can activate Ras-MAPK signaling opens the way for studies into perturbation of the Aurora A/H-Ras interaction and the effect on Ras-MAPK signaling. PMID: 28177880
  10. Peroxiredoxin I (Prx I) increased in tumors of hepatocellular carcinoma (HCC) patients that aligned with overexpression of oncogenic H-ras. PMID: 27517622
  11. Familial alcohol dependence was associated with hypomethylation of CpG sites in the HRAS promoter region. PMID: 28799801
  12. Suppression of MEK/ERK pathway in senescent cells provides a new strategy for elimination of Ras-expressing cells. PMID: 29140794
  13. ESR1 inhibits senescence-like phenotype and facilitates transformation induced by oncogenic ras in human mammary epithelial cells PMID: 27259243
  14. Data show that STK38 supports Ras-driven transformation through promoting detachment-induced autophagy. PMID: 27283898
  15. Data indicate acquired KRAS, NRAS or HRAS mutations in more than one third of patients after cetuximab exposure. PMID: 27119512
  16. HRAS mutations were more common in epithelial-myoepithelial carcinomas (EMCAs) with intact PLAG1 and HMGA2. Most EMCAs arose ex pleomorphic adenoma (PA)and the genetic profile of EMCA varies with the absence or presence of preexisting PA and its cytogenetic signature. Progression to higher grade EMCA with intact PLAG1 and HMGA2 correlates with the presence of TP53, FBXW7 mutations, or SMARCB1 deletion. PMID: 29135520
  17. Analysis of HRAS mutations and their respiratory phenotype revealed that the common p.Gly12Ser mutation is more often associated with transient respiratory distress and other respiratory diagnoses. PMID: 27102959
  18. we found that H-Ras proteins and particularly the G12V and G13D variants are significantly more flexible than their K-Ras counterparts.while most of the simulated proteins sampled the effector-interacting state 2 conformational state, G12V and G13D H-Ras adopted an open switch state 1 conformation that is defective in effector interaction PMID: 28498561
  19. The HRAS mutation p.T58I could manifest with severe early-onset but stabilizing cardiomyopathy. The dysmorphic features are mild compared with the features of Costello syndrome. The phenotypic variability makes the diagnosis challenging, suggesting that this variant of Costello syndrome might go undiagnosed. PMID: 26888048
  20. Age at diagnosis of follicular thyroid cancer (FTC) and frequency of extrathyroidal extension have changed over four decades; prevalence of RAS mutations has decreased; HRAS/NRAS (codon 61) and TERT (promoter) mutations may be associated with poor clinical outcomes in FTC, especially when two mutations coexist; this retrospective study was conducted in Seoul. PMID: 28864536
  21. Knockdown of forkhead Box M1 (FoxM1) reduced Prx II levels in H-ras(G12V)-hepatocellular carcinoma (HCC) cells, indicating FoxM1 as a direct transcription factor of Prx II in HCC. PMID: 26500057
  22. we found that ectopic expression of oncogenic KRas and HRas in cells resulted in elevated CIB1 expression. We previously described the Ca(2+)-myristoyl switch function of CIB1, and its ability to facilitate agonist-induced plasma membrane localisation of sphingosine kinase 1 (SK1), a location where SK1 is known to elicit oncogenic signalling. PMID: 27941888
  23. Data suggest that isoform-specific sequences in the allosteric lobes of HRAS, KRAS, and NRAS have an impact on biocatalysis (kinetics of GTP hydrolysis) and interaction with c-Raf kinase, which must be due to allosteric effects on dynamics and conformational states, given the identical active sites of these isoenzymes. PMID: 28630043
  24. Data suggest HRas activates both p110alpha and p110delta isoforms; membrane-resident HRas, not soluble HRas, increases membrane recruitment of both p110alpha and p110delta. (HRas = v-Ha-ras Harvey rat sarcoma viral oncogene homolog; p110alpha = class IA phosphoinositide 3-kinases, subunit p110alpha; p110delta = class IA phosphoinositide 3-kinases, subunit p110delta) PMID: 28515318
  25. Our data suggest that testing for any RAS mutation is unlikely to change the clinical management of thyroid nodules that have indeterminate cytology PMID: 28116986
  26. Equilibrium dissociation constants were determined for the binding of HRAS, KRAS, NRAS and RRAS2 to the RAS binding (RB) domain of binding proteins. PMID: 27936046
  27. Studies indicate that RAS proteins were among the first oncogenes identified and are mutationally activated in 30% of all cancer types. PMID: 28202657
  28. 6 of 7 (86%) malignant ectomesenchymomas had HRAS mutations PMID: 26872011
  29. RAS-positive thyroid cancer most often demonstrates indolent sonographic features and more commonly associates with lower risk, "indeterminate" cytology. PMID: 27689252
  30. Studies indicate that the control of spatiotemporal RAS protein signalling show that activation kinetics and subcellular compartmentalisation are tightly coupled to the generation of specific biological outcomes. PMID: 27911734
  31. HRAS mutation is associated in children with delayed puberty and probably with precocious puberty. PMID: 27940666
  32. HRAS mutation is associated with salivary duct carcinoma. PMID: 27379604
  33. Impact of SNPs on CpG Islands in the MYC and HRAS oncogenes and in a wide variety of tumor suppressor genes has been analyzed in a multi-cancer bioinformatics approach. PMID: 27074591
  34. Ras isoforms' dimer conformations are not uniform; instead, the isoform-specific dimers reflect the favoured interactions of the HVRs (hypervariable regions) with cell membrane microdomains, biasing the effector-binding site orientations, thus isoform binding selectivity. PMID: 27057007
  35. Two unrelated boys with Costello syndrome and an HRAS mutation (p.Gly13Cys) are presented with their ophthalmologic findings. Both had early symptoms of nystagmus, photophobia, and vision abnormalities PMID: 28337834
  36. The fact that no malignant tumors were described in these individuals does not allow definitive conclusions about the risk for cancer development. It remains to be determined if substitutions of amino acid 13 in HRAS (p.Gly13Asp and p.Gly13Cys) increase the risk of tumor development PMID: 28371260
  37. Overexpression of K-p21Ras was found in all colorectal cancer tissues tested, overexpression of N-p21Ras was found in 85.7% of the colorectal cancertissues, while H-p21Ras expression was not found in any colorectal cancer tissue. PMID: 28259994
  38. herefore, our results also demonstrate that the phenotype in CS and somatic cancers is not only determined by the different transforming potentials of mutant HRAS proteins, but also by the efficiency of exon 2 inclusion resulting from the different HRAS mutations. PMID: 27195699
  39. Point mutations of HRAS is associated with thyroid cancer. PMID: 27535135
  40. The results show that mutant RAS is associated with an earlier and higher rate of local tumour progression in patients undergoing ablation of CLMs. PMID: 28240361
  41. A report of three cases with pediatric urothelial bladder cancer indicates that the tumors are characterized by a consistent H-RAS mutation status, whereas FGFR3 and p53 pathways are not involved in this tumor initiation. PMID: 26522772
  42. The coexistence of BRAF or RAS mutations enhanced the prognostic effects of telomerase reverse transcriptase (TERT) promoter mutations. Furthermore, TERT promoter mutations strengthened the predictions of mortality and recurrence by the ATA and TNM staging systems, particularly for high-risk patients with differentiated thyroid cancer. PMID: 26969876
  43. Overexpression of HRAS is associated with Breast Cancer Recurrence. PMID: 27165221
  44. Study acts as a further supplement of the genetic features of neuroendocrine tumors. Somatic mutations of three potential tumor-related genes (HRAS, PAK1 and MEN1) might contribute to the tumorigenesis of thymic neuroendocrine tumors with EAS. PMID: 27913610
  45. Activating HRAS, KRAS and EGFR mutations play a major role in the pathogenesis of sporadic SGH. These results support the concept that SGH is a true benign neoplasm rather than a reactive hyperplasia. PMID: 26804118
  46. HRAS mutation is associated with liver cancer. PMID: 26799184
  47. findings support a role of HRAS mutations as a somatic driver event in benign PPGL without other known susceptibility gene mutations. HRAS mutated PPGL cluster together with NF1- and RET-mutated tumors associated with activation of kinase-signaling pathways PMID: 26773571
  48. Ras activity fine tunes the period length and modulates photoentrainment of the circadian clock. PMID: 25762011
  49. mTOR kinase inhibitor pp242 causes mitophagy terminated by apoptotic cell death in E1A-Ras transformed cells. PMID: 26636543
  50. Data show that Ba/F3 cells transformed with mutant HRAS protien indicated equal sensitivity towards Map kinase kinase (MEK) and mTOR serine-threonine kinase (mTOR) inhibition. PMID: 26544513

Show More

Hide All

Involvement in disease
Costello syndrome (CSTLO); Congenital myopathy with excess of muscle spindles (CMEMS); Thyroid cancer, non-medullary, 2 (NMTC2); Bladder cancer (BLC); Schimmelpenning-Feuerstein-Mims syndrome (SFM)
Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane; Lipid-anchor.; [Isoform 2]: Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Note=Colocalizes with RACK1 to the perinuclear region.
Protein Families
Small GTPase superfamily, Ras family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 5173

OMIM: 109800

KEGG: hsa:3265

STRING: 9606.ENSP00000309845

UniGene: Hs.37003

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*