Recombinant Rat Carbonic anhydrase 1 (Ca1)

In Stock
Code CSB-EP004364RAa2
Abbreviation Recombinant Rat Ca1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ca1; Car1Carbonic anhydrase 1; EC 4.2.1.1; Carbonate dehydratase I; Carbonic anhydrase I; CA-I
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
2-261aa
Target Protein Sequence
ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Carbonic anhydrase 1 (Ca1) gets expressed in E. coli and covers the full length of the mature protein from amino acids 2 to 261. The product comes with an N-terminal 6xHis-SUMO tag that makes purification and detection more straightforward. SDS-PAGE analysis shows a purity level greater than 90%. Research applications requiring precise protein characterization appear to be the main target for this product.

Carbonic anhydrase 1 (Ca1) catalyzes the reversible hydration of carbon dioxide to bicarbonate and protons. The enzyme seems to play a crucial role in regulating pH and ion balance in tissues. Various physiological processes likely depend on its function. Biochemical researchers find Ca1's activity and regulatory mechanisms particularly interesting since they may provide insights into metabolic pathways and potential therapeutic targets.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rat Ca1 is a zinc metalloenzyme that requires precise folding, proper zinc ion coordination, and specific active site formation for its catalytic activity in CO₂ hydration. The E. coli expression system can produce functional carbonic anhydrase when zinc is supplemented, but the large N-terminal 6xHis-SUMO tag (∼15 kDa) may sterically interfere with the protein's active site or oligomerization interfaces. While E. coli can fold some carbonic anhydrases correctly with zinc supplementation, the probability of correct folding with full enzymatic activity requires experimental validation, particularly given the potential tag interference.

1. Carbonic Anhydrase Enzyme Kinetics and Inhibitor Screening

This application carries a significant risk without functional validation. CA1 enzymatic activity requires precise zinc coordination and active site formation that may be compromised by the large N-terminal tag. If correctly folded and zinc-bound (verified through activity assays), the protein may be suitable for kinetic studies. If misfolded/inactive (unverified), kinetic measurements and inhibitor screening will yield biologically meaningless results. The SUMO tag may sterically block inhibitor access to the active site.

2. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional enzymatic activity. The full-length mature protein provides comprehensive epitope coverage for generating antibodies against rat CA1. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

3. Protein-Protein Interaction Studies

This application requires proper folding validation. CA1 interactions with other proteins require native conformation. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine protein interactions. The large SUMO tag may create artificial interaction surfaces.

4. Comparative Species Analysis and Evolutionary Studies

Meaningful comparative studies require native enzyme conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary comparisons of catalytic properties across species. If misfolded/inactive (unverified), comparative analyses would yield misleading evolutionary insights about CA1 function and adaptation.

Final Recommendation & Action Plan

The E. coli expression system can potentially produce functional carbonic anhydrase with zinc supplementation, but the large N-terminal 6xHis-SUMO tag poses a significant risk of interfering with enzymatic activity. Begin with enzymatic activity validation using standard CO₂ hydration assays and zinc content analysis before any functional applications. Applications 2 (antibody development) can proceed immediately. For Applications 1, 3, and 4, first confirm proper folding and catalytic activity. Consider tag removal or using smaller-tag constructs for critical kinetic and interaction studies. Always include zinc supplementation during expression and purification, and validate key findings with tag-free protein when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Reversible hydration of carbon dioxide.
Subcellular Location
Cytoplasm.
Protein Families
Alpha-carbonic anhydrase family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*