Recombinant Rat Carbonic anhydrase 1 (Ca1)

In Stock
Code CSB-EP004364RAa2
Abbreviation Recombinant Rat Ca1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ca1; Car1Carbonic anhydrase 1; EC 4.2.1.1; Carbonate dehydratase I; Carbonic anhydrase I; CA-I
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
2-261aa
Target Protein Sequence
ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Carbonic anhydrase 1 (Ca1) gets expressed in E. coli and covers the full length of the mature protein from amino acids 2 to 261. The product comes with an N-terminal 6xHis-SUMO tag that makes purification and detection more straightforward. SDS-PAGE analysis shows a purity level greater than 90%. Research applications requiring precise protein characterization appear to be the main target for this product.

Carbonic anhydrase 1 (Ca1) catalyzes the reversible hydration of carbon dioxide to bicarbonate and protons. The enzyme seems to play a crucial role in regulating pH and ion balance in tissues. Various physiological processes likely depend on its function. Biochemical researchers find Ca1's activity and regulatory mechanisms particularly interesting since they may provide insights into metabolic pathways and potential therapeutic targets.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Carbonic Anhydrase Enzyme Kinetics and Inhibitor Screening

Scientists can use this recombinant rat CA1 protein to set up in vitro enzyme assays for studying carbonic anhydrase catalytic properties and kinetic parameters. The full-length mature protein (2-261aa) expressed in E. coli offers a cost-effective source for high-throughput screening of potential carbonic anhydrase inhibitors. That N-terminal His-SUMO tag makes purification easier and helps with immobilization for automated screening platforms. Researchers can evaluate inhibitor specificity, IC50 values, and structure-activity relationships using this purified enzyme preparation.

2. Antibody Development and Validation

The high purity recombinant rat CA1 protein works well as an immunogen for generating species-specific antibodies against rat carbonic anhydrase 1. Pull-down assays and ELISA-based screening can take advantage of the His-SUMO tag to identify and characterize antibody candidates during hybridoma development. This protein may also serve as a positive control and standard for validating antibody specificity in Western blotting, immunoprecipitation, and other immunoassays targeting rat CA1.

3. Protein-Protein Interaction Studies

Biochemical assays can make use of the tagged recombinant protein to identify and characterize potential binding partners of rat carbonic anhydrase 1. The His tag allows immobilization on nickel-affinity matrices for pull-down experiments with rat tissue lysates or cell extracts. Co-immunoprecipitation studies and surface plasmon resonance analyses can determine binding kinetics and affinities of identified interaction partners, though results might vary depending on experimental conditions.

4. Comparative Species Analysis and Evolutionary Studies

This rat CA1 protein appears to be a valuable tool for comparative biochemistry studies examining carbonic anhydrase function across different mammalian species. Researchers can perform side-by-side enzymatic comparisons with human or mouse carbonic anhydrase orthologs to understand species-specific differences in catalytic efficiency and substrate preferences. The recombinant protein creates controlled experimental conditions for studying evolutionary adaptations in carbonic anhydrase function among rodent species, though some caution is needed when extrapolating results across distantly related species.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Reversible hydration of carbon dioxide.
Subcellular Location
Cytoplasm.
Protein Families
Alpha-carbonic anhydrase family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*