Recombinant Rat Carbonic anhydrase 1(Ca1)

Code CSB-EP004364RAa2
Product Type Recombinant Protein
Size US$2466
Uniprot No. B0BNN3
Relevance Reversible hydration of carbon dioxide.Curated
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Carbonate dehydratase I
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Research Area Others
Source E.coli
Gene Names Ca1
Expression Region 2-261aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 44.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Reversible hydration of carbon dioxide.
Subcellular Location Cytoplasm
Protein Families Alpha-carbonic anhydrase family
Database Links

KEGG: rno:310218

STRING: 10116.ENSRNOP00000014267

UniGene: Rn.6854

Related Products

Ca1 Antibodies

Ca1 Antibodies for Rat

Ca1 Antibodies for Rattus norvegicus (Rat)

Ca1 Proteins

Ca1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.