Recombinant Human Interleukin-8(CXCL8) (Active)

In Stock
Code CSB-AP004621HU
Size US$2614Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 15 ng/mL.
Target Names CXCL8
Uniprot No. P10145
Research Area Immunology
Alternative Names (Ala-IL-8)77; (Ser-IL-8)72; 9E3; Beta thromboglobulin like protein; C-X-C motif chemokine 8; CEF-4; chemokine; CXC motif; ligand 8; CXCL8; Emoctakin; GCP-1; GCP/IL-8 protein I; GCP/IL-8 protein II; GCP/IL-8 protein III; GCP/IL-8 protein IV; GCP/IL-8 protein V; GCP/IL-8 protein VI; GCP1; Granulocyte chemotactic protein 1; IL-8; IL-8(1-77); IL-8(9-77); IL8; IL8/NAP1 form I; IL8/NAP1 form II; IL8/NAP1 form III; IL8/NAP1 form IV; IL8/NAP1 form V; IL8/NAP1 form VI; IL8_HUMAN; Inteleukin 8; LECT; LUCT; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF; MDNCF-b; MDNCF-c; MONAP; Monocyte derived neutrophil activating peptide; Monocyte derived neutrophil chemotactic factor; Monocyte-derived neutrophil chemotactic factor; Monocyte-derived neutrophil-activating peptide; NAF; NAP 1; NAP-1; NAP1; Neutrophil activating peptide 1; Neutrophil activating protein 1; Neutrophil-activating factor; Neutrophil-activating protein 1; Protein 3 10C; Protein 3-10C; SCYB 8; SCYB8; Small inducible cytokine subfamily B member 8; T cell chemotactic factor ; T-cell chemotactic factor; TSG 1; TSG1
Species Homo sapiens (Human)
Source E.coli
Expression Region 23-99aa
Complete Sequence AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Mol. Weight 8.9 kDa
Protein Length Full Length of Mature Protein
Tag Info Tag-Free
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Gene References into Functions
  1. VEGF and IL-8 play a prominent role in the pathogenesis of early forms of rosacea and the hemostasis system. PMID: 29578433
  2. High levels of LIFR in colorectal cancer (CRC) facilitated proliferation and migration of endothelial cells, resulting in an increase in angiogenic activity. Moreover, IL-8 was found to play a role in the LIFR induced angiogenesis. IL-8 levels were correlated with LIFR levels in CRC tissues, whereas depletion of IL-8 led to a reduced angiogenic activity of LIFR in CRC cells. PMID: 29751081
  3. PKC-delta isoform plays a crucial role in Tat-TLR4 signaling pathway to activate NF-kappaB and CXCL8 production. PMID: 28539656
  4. CXCL8 was a target of miR-204, and miR-204 suppression could not increase cell viability, migration, invasion, and EMT procedure when CXCL8 was silenced. PMID: 29402343
  5. Interleukin 8 - 845 T/C and + 781 C/T polymorphisms were analyzed. For + 781C/T locus, in the dominant genetic model, significant difference between TT vs. CC + CT genotypes that significantly had a protective role against periodontitis disease. Positive association between distribution of IL8 - 845 T/C alleles and risk of periodontitis disease. C allele of IL-8 - 845 increased the risk of periodontitis disease. PMID: 30078118
  6. These results suggest a direct involvement of IL-8-CXCR1/2 axes in GBM progression by promoting both cell proliferation and invasion and indirectly by promoting neovascularization in the form of vascular mimicry. PMID: 30086759
  7. These results show that AKIP1 is crucial in cervical cancer angiogenesis and growth by elevating the levels of the NF-kappaB-dependent chemokines CXCL1, CXCL2, and CXCL8. PMID: 29520695
  8. The extramembranous domain of HofQ (emHofQ) was shown to interact with various cytokines, of which IL-8 exhibited the strongest interaction. PMID: 30088437
  9. he protein expression levels of IL-8 were significantly decreased in SZ patients, but no significant difference in the mRNA levels of IL-8 was observed between SZ patients and NC subjects. PMID: 28476335
  10. immune system process is indispensable in the progression of disease in colon, and identifies that IL-8 and MMP-9 play potential critical roles for the progression. PMID: 30074183
  11. IL-8 production was significantly enhanced following treatment with both IL-17A and CSE, while treatment with either IL-17A or CSE alone caused only a slight increase in IL-8 production. PMID: 29463070
  12. Work identified IL-8 as a positive regulator of homotypic CIC formation via enhancing intercellular adhesion. PMID: 30021676
  13. V2O5 induction of CXCL8 and CXCL11 chemokines may lead to the appearance and perpetuation of an inflammatory reaction into the dermal tissue. Further studies are required to evaluate dermal integrity and manifestations in subjects occupationally exposed, or living in polluted areas. PMID: 29901202
  14. Study findings point out that PAR2 could play an essential role in gastroesophageal reflux disease (GERD) pathogenesis - even repeated short-term exposure to weakly acidic conditions lead to the upregulation of PAR2 and subsequent activation of the intense IL-8 release in the esophageal mucosa and initiation of mucosal immune response in GERD. PMID: 29672302
  15. Given that IL-8, MIP-1beta, and MCP-1 are chemokines that play important roles in recruitment of immunocompetent cells for immune defense and tumor cell clearance, the observed lower levels of these markers with increasing PM2.5 exposure may provide insight into the mechanism by which DEE promotes lung cancer. PMID: 29023999
  16. These results suggested that stemness induction in SKOV3 cells by macrophages co-cultured with SKOV3-derived OCSLCs involved IL-8/STAT3 signaling. PMID: 29656182
  17. IL-8-251T>A (rs4073) Polymorphism is associated with gastric Cancer. PMID: 30275190
  18. expression level of CXCL8 had a positive relationship with recurrence probability in Acute myeloid leukemia. PMID: 29596823
  19. These data were in close agreement with the reduced cell migration and colony formation. Results from the present study suggested that reparixin and SCH527123 may be promising therapeutic agents for the treatment of pancreatic cancer by inhibiting the IL8/CXCR1/2 signaling cascade. PMID: 29749433
  20. A urinary IL-8 level of less than 61.25 pg/ml is more sensitive for prediction of complete remission in idiopathic membranous nephropathy patients. PMID: 29415357
  21. berberine inhibited the expression of MCP-1 and IL-8 induced by LPS. PMID: 28852897
  22. Regarding the IL-8 promoter T - 251A, the TA and AA genotypes were associated with significantly decreased risks of nasopharyngeal carcinoma (NPC) in a Taiwanese population compared with the wild-type TT genotype. The mRNA and protein expression levels for NPC tissues revealed no significant associations among the 20 NPC samples with different genotypes. PMID: 30200105
  23. IL-8 +781 T/C polymorphism is associated with the severe Clostridium difficile infection PMID: 29203364
  24. ShRNA mediated down-regulation of CXCL8 resulted in inhibition of cell proliferation, viability and invasion in vitro and a near complete growth reduction of tumor in vivo. PMID: 29679563
  25. CSF IL-8 concentrations were significantly elevated in CNS tumor patients as compared to non-tumoral individuals. AUC for CSF IL-8 was higher than for its index (CSF IL-8/serum IL-8). PMID: 29086194
  26. High IL8 expression is associated with melanoma. PMID: 29286146
  27. Lipo-CPFX, but not CPFX, retained the anti-IL-8 releasing activity. PMID: 29337216
  28. The results indicate significant contribution of IL8 on survival of hormonal dependent early-stage breast cancer patients and association with established parameters such as estrogen receptors/progesterone receptor and HER2. PMID: 28569250
  29. the frequency of non-classical monocytes expressing CXCL8 was increased in systemic sclerosis patient and monocytes expressing CXCL8 PMID: 29127442
  30. ntermediate Molecular Mass Hyaluronan and CD44 interactions enhanced normal PMN phagocytosis and IL-8 production PMID: 28730511
  31. serum levels in active vitiligo significantly elevated compared to those in stable vitiligo patients PMID: 29115683
  32. High IL8 expression is associated with pancreatic adenocarcinoma. PMID: 29205349
  33. Compared with controls, the interleukin (IL)-8 A/A genotype was more common in acute pancreatitis (AP). PMID: 29215544
  34. The presence of neither the first transmembrane helix of the receptor nor the lipid bilayer significantly affected the interactions of IL-8 with Binding Site-I of CXCR1. PMID: 29143165
  35. CXCL8 is highly expressed in cervical cancer tissues and cell lines, and correlated with malignant status and prognosis in cervical cancer patients. PMID: 28883082
  36. In conclusion, to our knowledge, this is the first study in the association of rs4073 and rs2227306 polymorphisms with childhood asthma risk in the Tunisian population. PMID: 28993876
  37. Results show that IL8 expression level is regulated by APE1 which activates NF-KB. PMID: 27388124
  38. aberrant miR-520c-3p expression may lead to reduced IL-8 expression and promote the mesenchymal phenotype in breast cancer cells, thereby increasing invasive growth. PMID: 29048659
  39. increased levels of IL-8 are associated with factors of worse prognosis in ovarian cancer PMID: 28872976
  40. Significantly elevated blood levels of IL-8 in myelodysplastic syndrome patients. PMID: 28856536
  41. the elevated concentrations of CXCL13, CXCL8, and CXCL10 or their increasing CSF/serum ratios may be potential biomarkers of neurosyphilis PMID: 27650493
  42. Results implicated the important role of PRL-3 in glycolysis metabolism through improving IL-8 secretion in colorectal cancer cells, and PRL-3 mediated glycolysis contributed to the promotion of cancer metastasis. PMID: 28791350
  43. Changes in serum IL-8 levels could be used to monitor and predict clinical benefit from immune checkpoint blockade in melanoma and NSCLC patients PMID: 28595336
  44. Lung cancer patients showed significantly lower levels of serum VEGF (1.9 fold) and IL-8 (~9 fold) than COPD patients. VEGF level was significantly higher (2.6 fold) in metastatic than non-metastatic cancer patients. An increase in MMP-9 (~1.6 fold) levels was observed in lung cancer patients. PMID: 27811960
  45. CXCL1/8 secreted by adipose-derived mesenchymal stem cells could promote breast cancer angiogenesis. PMID: 28514506
  46. our meta-analysis suggests that the IL-8 rs4073, A2767T, T11722T2, rs2234671, rs2230054, rs1126579, rs2227306, rs2227307, rs2227532, and T-738A polymorphisms are not associated with periodontitis while the IL-8 C1633T and rs1126580 polymorphisms may elevate the susceptibility of periodontitis based on the currently available evidences. PMID: 28446725
  47. An analogue of human CXCL8, CXCL8(3-72)K11R/G31P (hG31P) has been developed. PMID: 28754019
  48. inflammation triggered property of Microcystin-LR via IL-8/CXCR2 signaling PMID: 29197248
  49. A high IL-8 content in urine sampled on day 1 after renal transplantation was positively correlated with the activity of metalloproteinase-9 in urine. This proves that both of these chemokines cooperate in ischaemia-reperfusion injuries in transplanted kidneys. PMID: 28494217
  50. We discovered that IL-8 secreted from decidual stromal cells is a key cytokine enhancing the invasiveness of trophoblasts PMID: 28328096
  51. these findings demonstrated that poly I:C accelerated collective HaCaT cell migration via autocrine/paracrine secretions of IL-8 and the subsequent incomplete epithelial-mesenchymal transition PMID: 28438134
  52. Blocking of GPR68 or NF-small ka, CyrillicB activity severely attenuated acidification induced IL-8 production. PMID: 27166427
  53. Suggest that an increased concentration of IL-8 is associated with resting pain in rotator cuff tear patients. PMID: 25930944
  54. The results of the transwell chemotaxis assay also supported the above results. Our data suggest that APN can promote h-JBMMSC chemotaxis by up-regulating CXCL1 and CXCL8 PMID: 28176455
  55. IL-8 has an important role in HNSCC progression via CXCR1/2-mediated NOD1/RIP2 signaling PMID: 27557518
  56. We suggest that a combination of H. pylori infection and the IL-8 -251 T > A polymorphism might increase the risk of severe AG and GC in a Korean population PMID: 28558668
  57. Knockdown of IL-8 Provoked Premature Senescence of Placenta-Derived Mesenchymal Stem Cells.( PMID: 28418782
  58. IL-33 induces IL-8 expression via JNK/c-Jun/AP-1 pathway in human vascular endothelial cells, and provides a new insight into the role of IL-33-induced IL-8 in the pathophysiology of atherosclerosis and vascular inflammation PMID: 29373608
  59. these findings indicate that leptin may promote tumor growth and metastasis by stimulating IL-8 production in tumor-associated macrophage PMID: 27588409
  60. Up-regulation of IL-8 and its association with the marker of clinical and inflammatory activity, CRP, suggest a role of this cytokine in the pathogenesis of chronic spontaneous urticaria. PMID: 29254299
  61. data obtained suggests the importance of IL-8 in the direct regulation of adaptive T cell reactivity PMID: 28667886
  62. sohlh2 functions as a tumor metastasis suppressor via suppressing IL-8 expression in breast cancer PMID: 27384482
  63. Claudin-5 was shown to be regulated VEGFR2/PI3K-Akt dependently by VEGF and PI3K-Akt independently by histamine. Interleukin-8 was shown to downregulate claudin-5 by histamine. PMID: 27873103
  64. Levels of IL-8 in CSF were significantly higher in multiple sclerosis (MS) patients than in controls. Serum levels of IL-8 were significantly lower in MS patients than in controls. PMID: 28619424
  65. Association of polymorphic markers of chemokine genes, their receptors, and CD14 gene with coronary atherosclerosis PMID: 29369549
  66. gene polymorphisms of IL-8(-251T/A) and IP-10(-1596C/T) are associated with susceptibility and progression of type 2 diabetic retinopathy in a northern Chinese population PMID: 27935598
  67. Recombinant OmpU (rOmpU) of V. cholerae induced IL-8 expression at the mRNA and protein levels in a dose- and time-dependent manner in HT-29 cells. IL-8 was secreted through both apical and basolateral sides of the polarized HT-29 cells upon apical exposure to rOmpU but not upon basolateral exposure. PMID: 29145158
  68. that the mRNA expression of the chemokine IL-8 is significantly lower in samples from interstitial fibrosis/tubular atrophy patients than in samples from patients with stable graft function PMID: 27693310
  69. Study provides evidence that IL-8 promotor is activated by the binding of RELA to TWIST1. PMID: 28283022
  70. In this review, we summarize the biological functions and clinical significance of the CXCL8-CXCR1/2 signaling pathway in cancer. Targeting CXCL8 or CXCR1/2 may be an attractive therapeutic strategy for tumors. PMID: 27578214
  71. IL-8 has a role in lung carcinoma resistance to erlotinib PMID: 27248176
  72. USP21 binds to the promoter region of IL-8 and mediates transcriptional initiation, which regulates the stem-cell like property of human renal cell carcinoma PMID: 27259257
  73. Relationship of inflammatory profile of elderly patients serum and senescence-associated secretory phenotype with human breast cancer cells proliferation: Role of IL6/IL8 ratio.( PMID: 27951455
  74. in the presence of autologous platelets, monocytes from older adults synthesized greater IL-8 than younger adults PMID: 29167233
  75. The mo-DCs from HIV-1 infected patients depicted functional exhaustion as evident by decreased allo-stimulation index (mean+/-SD: 10+/-6 vs. 24+/-16) (p<0.05), decreased cytokine production (pg/ml) (IL-12: 4.6+/-16 vs. 25+/-85; TNF-alpha: 128+/-279 vs. 286+/-544; IL-10: 6+/-12 vs. 13+/-20; IL-8: 10,688+/-11,748 vs. 17,470+/-125,049) and retained endocytosis (1.1+/-0.3 vs. 1.0+/-0.29) (p<0.05) even after LPS-stimu... PMID: 28056393
  76. Interaction of Monomeric Interleukin-8 with CXCR1 PMID: 29262362
  77. lactobacilli from the omnivorous group and all bifidobacteria significantly down-regulated IL-8. Notably, both genera also lowered the TSLP expression in stimulated Caco-2 cells, regardless of the diet regimen. PMID: 27863334
  78. The serum levels of IL-8, MIP-1 alpha, MIP-1 beta, MMP-8, Resistin, FLRG, and BCAM were significantly higher in breast cancer patients, but LAP and TSH-beta levels were lower. PMID: 26898119
  79. Oral and periodontal innate immunity is affected by HIV viremia and ART. GCF IL-8, G-CSF, as well as serum IL-8, MCP-1 and GM-CSF may be useful biomarkers for the detection of disease presence and/or its severity due to HIV infection and ART use. PMID: 28043030
  80. first study to investigate the concentrations of CXCR-1 and CXCR-2 with the levels of IL-8 in colostrum and mature human milk of term and preterm newborns PMID: 27105439
  81. lithocholic acid activated Erk1/2 and in turn, suppressed STAT3 phosphorylation to induce IL-8 expression in HCT116 cells, thus stimulating endothelial cell proliferation and tube like formation. PMID: 28247965
  82. CD109 knockdown upregulated IL-8 expression through activation of TGF-beta/Akt/NF-kappaB pathway in human umbilical vein endothelial cellsk PMID: 27121053
  83. Strawberry tannins inhibit IL-8 secretion in a cell model of gastric inflammation. PMID: 27473819
  84. The greater aggressiveness of bcl-xL-overexpressing melanoma cells was mediated by an autocrine effect of CXCL8 on its CXCR2 receptor, as confirmed by an shRNA approach. PMID: 28949016
  85. The strongest OR was for CXCL8 (interleukin-8) in serum (96.8, 95% CI: 11.9-790.2). Of these 15 markers, 6 were also significantly elevated in serum from Chile (CCL20, C-reactive protein, CXCL8, CXCL10, resistin, serum amyloid A). PMID: 27173614
  86. IL-8, but not the CXCL1 circuit, is critical for the regulation of thyroid cancer stem cells. PMID: 27577959
  87. IL-8 A-251 TT genotype may contribute to the differentiated thyroid carcinoma lymph node metastasis. PMID: 28164553
  88. Taken together, the data presented here suggest that TLR2 activation in human mast cells promotes the release of inflammatory mediators via distinct signaling pathways that partially depend on the action of Go proteins. PMID: 27515449
  89. ERRalpha can trigger the proliferation and migration of colorectal cancer cells via up regulation of IL-8. PMID: 28993941
  90. elevated intracystic il-8 levels are associated with worse prognosis in ovarian cancer PMID: 28960399
  91. Elevation of IL8 in bile of primary sclerosing cholangitis (PSC) patients, collected at different stages of disease, indicates an ongoing inflammatory stimulus that drives IL8 production. This challenges the idea that advanced PSC is a burned-out disease, and calls for reconsideration of anti-inflammatory therapy in PSC. PMID: 26866350
  92. Diagnostic value of sTREM-1, IL-8, PCT, and CRP in febrile neutropenia after autologous stem cell transplantation PMID: 28920169
  93. PROX1 activated nuclear factor kappaB signaling and selectively promoted expression of the proangiogenic interleukin-8 by epigenetically stimulating the IL-8 promoter. PMID: 28646551
  94. High IL8 expression is associated with alcoholic hepatitis. PMID: 28818508
  95. data showed that HDAC1 can trigger the proliferation and migration of breast cancer cells via activation of Snail/IL-8 signals PMID: 28779562
  96. ATP-induced IL-8 release maybe involved in the pathogenesis of refractory gastroesophageal re fl ux disease. PMID: 27977904
  97. Data suggest that primary cells from papillary renal cell carcinoma secrete the chemokines IL8, CXCL16, and chemerin; these chemokines attract primary human monocytes and induce shift/transdifferentiation in monocytes toward M2 macrophage/foam cell phenotype. (IL8 = interleukin-8; CXCL16 = C-X-C motif chemokine ligand 16) PMID: 28759013
  98. findings strongly suggest that P. gingivalis infection plays an important role in the promotion of the invasive potential of oral squamous cell carcinoma cells via the upregulation of IL-8 and MMPs. PMID: 27468958
  99. miR-424-5p expression in oral squamous cell carcinoma cells could be induced by IL-8 through increasing STAT5 transcriptional activity. PMID: 27038552
  100. IL-8 in serum is a predictor of short-time mortality in patients with acute hypercapnic respiratory failure and acute exacerbation of COPD treated with noninvasive positive pressure ventilation. PMID: 28178959

Show More

Hide All

Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 6025

OMIM: 146930

KEGG: hsa:3576

STRING: 9606.ENSP00000306512

UniGene: Hs.624

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1