Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 15 ng/mL.
Alternative Names
(Ala-IL-8)77; (Ser-IL-8)72; 9E3; Beta thromboglobulin like protein; C-X-C motif chemokine 8; CEF-4; chemokine; CXC motif; ligand 8; CXCL8; Emoctakin; GCP-1; GCP/IL-8 protein I; GCP/IL-8 protein II; GCP/IL-8 protein III; GCP/IL-8 protein IV; GCP/IL-8 protein V; GCP/IL-8 protein VI; GCP1; Granulocyte chemotactic protein 1; IL-8; IL-8(1-77); IL-8(9-77); IL8; IL8/NAP1 form I; IL8/NAP1 form II; IL8/NAP1 form III; IL8/NAP1 form IV; IL8/NAP1 form V; IL8/NAP1 form VI; IL8_HUMAN; Inteleukin 8; LECT; LUCT; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF; MDNCF-b; MDNCF-c; MONAP; Monocyte derived neutrophil activating peptide; Monocyte derived neutrophil chemotactic factor; Monocyte-derived neutrophil chemotactic factor; Monocyte-derived neutrophil-activating peptide; NAF; NAP 1; NAP-1; NAP1; Neutrophil activating peptide 1; Neutrophil activating protein 1; Neutrophil-activating factor; Neutrophil-activating protein 1; Protein 3 10C; Protein 3-10C; SCYB 8; SCYB8; Small inducible cytokine subfamily B member 8; T cell chemotactic factor ; T-cell chemotactic factor; TSG 1; TSG1
Species
Homo sapiens (Human)
Expression Region
23-99aa
Complete Sequence
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If
you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the
bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We
recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at
-20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.