Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004841MO |
| Product Type | Interleukin |
| Size | US$195 |
| Uniprot No. | P18893 |
| Lead Time | 5-10 business days |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alias | Interleukin-10;Il10;IL-10;Cytokine synthesis inhibitory factor;CSIF; |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
| Research Area | Immunology |
| Source | E.coli |
| Gene Names | Il10 |
| Expression Region | 19-178aa |
| Tag Info | Tag-Free |
| Mol. Weight | 18.9 kDa |
| Protein Description | Full Length of Mature Protein |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. |
| Subcellular Location | Secreted |
| Protein Families | IL-10 family |
| Database Links |
KEGG: mmu:16153 STRING: 10090.ENSMUSP00000016673 UniGene: Mm.874 |
| Pathway |
Jak-STAT signaling pathway
T cell receptor signaling pathway FoxO signaling pathway |
Il10 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP011580MO CSB-EP011580MO CSB-BP011580MO CSB-MP011580MO |
Recombinant Mouse Interleukin-10(Il10) | Yeast E.coli Baculovirus Mammalian cell |
| CSB-AP003351MO | Recombinant Mouse Interleukin-10 protein(Il10) (Active) | E.coli |
Il10 ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E04594m | Mouse interleukin 10,IL-10 ELISA KIT | serum, plasma, cell culture supernates, tissue homogenates | 0.78 pg/mL |
Recombinant Human Endothelin-1 receptor(EDNRA)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Mouse Lysyl oxidase homolog 1(Loxl1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human DNA-(apurinic or apyrimidinic site) lyase(APEX1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Collagen alpha-1(XVIII) chain(COL18A1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.