Recombinant Mouse Interleukin-10(Il10)

In Stock
Code CSB-AP004841MO
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P18893
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Interleukin-10;Il10;IL-10;Cytokine synthesis inhibitory factor;CSIF;
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Research Area Immunology
Source E.coli
Gene Names Il10
Expression Region 19-178aa
Tag Info Tag-Free
Mol. Weight 18.9 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular Location Secreted
Protein Families IL-10 family
Database Links

KEGG: mmu:16153

STRING: 10090.ENSMUSP00000016673

UniGene: Mm.874

Pathway Jak-STAT signaling pathway
T cell receptor signaling pathway
FoxO signaling pathway

Related Products

Il10 Proteins

Il10 Proteins for Mus musculus (Mouse)

Il10 ELISA Kit

Il10 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.