Recombinant Mouse Interleukin-13(Il13),partial

In Stock
Code CSB-AP004771MO
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P20109
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 10 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Research Area Immunology
Source E.coli
Gene Names Il13
Expression Region 26-131aa
Tag Info Tag-Free
Mol. Weight 11.7 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages
Subcellular Location Secreted
Protein Families IL-4/IL-13 family
Database Links

KEGG: mmu:16163

STRING: 10090.ENSMUSP00000020650

UniGene: Mm.1284

Pathway Jak-STAT signaling pathway
Fc epsilon RI signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation

Related Products

Il13 Proteins

Il13 Proteins for Mus musculus (Mouse)

Il13 ELISA Kit

Il13 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.