Home
Protein
Recombinant Proteins
Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial

^{In Stock}

Code	CSB-EP2355DIL1
Abbreviation	Recombinant Zebrafish tnfb protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

TNF superfamily, member 2

Uniprot No.

Q4W898

Research Area

others

Source

E.coli

Expression Region

101-242aa

Target Protein Sequence

AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.8 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Discover the superior quality of our Recombinant Danio rerio tnfb, a protein that features Lymphotoxin-alpha (TNF-beta), a vital component of the Tumor necrosis factor ligand superfamily member 1, derived from Danio rerio (Zebrafish). This recombinant protein is expressed in E.coli, encompasses a partial protein length, and spans an expression region from 101-242aa.

With an N-terminal 6xHis-tag for seamless detection and purification, our product boasts a purity greater than 85% as determined by SDS-PAGE, ensuring consistent results in your research. The supplied form is a convenient lyophilized powder, making it an excellent choice for various applications. Trust the precision and reliability of our Recombinant Danio rerio tnfb for your research needs.