Recombinant Rat Retinoblastoma-associated protein (Rb1), partial

Code CSB-RP155294r(A3)
Abbreviation Recombinant Rat Rb1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
Rb1; Rb-1; Retinoblastoma-associated protein; pRb; Rb; pp105
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
721-919aa
Target Protein Sequence
KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTRTRMQKQKLNDSMEISNKEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tumor suppressor that is a key regulator of the G1/S transition of the cell cycle. The hypophosphorylated form binds transcription regulators of the E2F family, preventing transcription of E2F-responsive genes. Both physically blocks E2Fs transactivating domain and recruits chromatin-modifying enzymes that actively repress transcription. Cyclin and CDK-dependent phosphorylation of RB1 induces its dissociation from E2Fs, thereby activating transcription of E2F responsive genes and triggering entry into S phase. RB1 also promotes the G0-G1 transition upon phosphorylation and activation by CDK3/cyclin-C. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV39H1, KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. Mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex.
Gene References into Functions
  1. Identify Dyrk1a as a novel negative regulator of D-cyclin-mediated Rb1/E2f-signalling. As dysregulation of this pathway with impaired cardiomyocyte proliferation leads to cardiomyopathy. PMID: 27056896
  2. Inflammation disrupts LDLr feedback regulation through the activation of the mTOR pathway, increasing mTORC1 activity and up-regulating SREBP-2-mediated cholesterol uptake through Rb phosphorylation. PMID: 24068000
  3. Phosphorylated retinoblastoma protein (p-Rb) is involved in neuronal apoptosis after traumatic brain injury in adult rats. PMID: 23371354
  4. a role for Rb protein in directing oncogenic cell growth PMID: 22885065
  5. Rb pathway may only be involved in early neuronal apoptosis and may be not an apoptotic signal in the late stages of transient cerebral ischemia. PMID: 19123049
  6. Results indicate that HIV-infection in the brain is associated with site-specific hyperphosphorylation of pRb at serine795, and that this phosphorylation contributes to neuronal death in this disease. PMID: 21504794
  7. Data show that proliferaton and nuclear expression of cyclin D1 and p-Rb coincide with the early phase of cyst growth, suggesting that there might be a therapeutic window in which cyclin-dependent kinase inhibitors are most effective in ARPKD. PMID: 20924203
  8. proliferative lesions activate the cell cycle machinery following tumor promotion via a regulatory mechanism involving inactivation of GSK3beta and retinoblastoma protein PMID: 19505811
  9. These data demonstrate how a new molecular network on ATM regulates the cell cycle through the control of pRb phosphorylation. PMID: 20213763
  10. Expression of Rb is closely event-related to malignant transformation and conversion of the oral mucosa, and is a reliable biomarker linked to oral cancer pathogenesis. PMID: 20023236
  11. employs both canonical cyclin-dependent kinase/cyclin regulation and metabolic regulation as a means to limit proliferation, underscoring its potency in tumor suppression PMID: 12221087
  12. Rb is present in rat and human islets, and overexpression of cyclin D(1)/cdk-4 led to strikingly enhanced Rb phosphorylation. PMID: 14693709
  13. Mitogen-induced rapid phosphorylation of serine 795 of the retinoblastoma gene product in vascular smooth muscle cells involves ERK activation PMID: 15069084
  14. MyoD may function in myonuclei in response to denervation to protect against denervation-induced apoptosis via perhaps the activation of p21 and Rb PMID: 15084472
  15. continued RB action is required for the maintenance of two kinetically and functionally distinct modes of replication inhibition PMID: 15169903
  16. RB plays a role in the early neural differentiation of mysenchymal stem cells through histone deacetylases dependent pathways. PMID: 15459751
  17. the derepression of Rb-E2F-regulated genes leads to apoptosis through inactivation of focal adhesion kinase and activation of caspase-8 PMID: 15640164
  18. Caspase-9 antagonizes p53-induced apoptosis by generating a p76(Rb) truncated form of Rb PMID: 15735701
  19. ERK1/2 mediates EGF-induced rapid Rb phosphorylation at Ser780 and Ser795 PMID: 16126730
  20. deregulation of p16-cyclin D1/Cdk4-Rb pathway, but not oncogenic activation of ras, plays a crucial role in bladder tumorigenesis induced by bladder calculi PMID: 16896691
  21. Results suggest that phosphorylation of the cell cycle regulator, Rb, contributes to death in oxygen-glucose deprivation in septal neurons but Cdk5 can have a protective role. PMID: 18351461
  22. Results show that the Rb-E2F pathway functions as a bistable switch to convert graded serum inputs into all-or-none E2F responses. PMID: 18364697
  23. Results suggest that proper CXCR4 stimulation by CXCL12 in the mature CNS can prevent impairment of the Rb-E2F pathway and support neuronal survival. PMID: 18583990
  24. Ink4a/Cdk4/Rb1 pathway deregulation, more than Arf/Mdm2/Tp53 pathway, has a major role in the development of these tumors through p16(Ink4a) deregulation. PMID: 18656278
  25. Cdk2 signaling pathways are critical regulators of cardiac I/R injury in vivo and support a cardioprotective role for Rb PMID: 18692063
  26. These results indicate that cyclin D-cdk4/6-dependent phosphorylation of pRb and activation of E2F is necessary for hypertrophic growth in cardiomyocytes. PMID: 18700867

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Retinoblastoma protein (RB) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*