Recombinant Human Interleukin-8(CXCL8)

In Stock
Code CSB-AP004641HU
Product Type Interleukin
Size US$124
Uniprot No. P10145
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-8; IL-8; C-X-C Motif Chemokine 8;CXCL8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 25 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Research Area Immunology
Source Mammalian cell
Gene Names CXCL8
Expression Region 21-99aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 10.1 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 6025

OMIM: 146930

KEGG: hsa:3576

STRING: 9606.ENSP00000306512

UniGene: Hs.624

Pathway Chemokine signaling pathway
NF-kappa B signaling pathway
Cellular senescence
IL-17 signaling pathway
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Oxidative Phosphorylation
Phospholipase D signaling pathway

Related Products

CXCL8 Antibodies

CXCL8 Antibodies for Homo sapiens (Human)

CXCL8 Antibodies for Human

CXCL8 Proteins

CXCL8 Proteins for Homo sapiens (Human)

CXCL8 ELISA Kit

CXCL8 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.