Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-YP333489ACY |
| MSDS | |
| Size | Pls inquire |
| Source | Yeast |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP333489ACY-B |
| MSDS | |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-BP333489ACY |
| MSDS | |
| Size | Pls inquire |
| Source | Baculovirus |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-MP333489ACY |
| MSDS | |
| Size | Pls inquire |
| Source | Mammalian cell |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Can you please provide the following information regarding CSB-BP333489ACY:
1. Sequence
2. Tag type
3. Tag position
4. Sizes and formats
**We would like to know if we can purchase the cDNA clones of this proteins?
GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA