Recombinant Plasmodium falciparum Glutathione S-transferase (GST)

In Stock
Code CSB-YP847596PLO
Abbreviation Recombinant Plasmodium falciparum GST protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GST
Uniprot No.
Research Area
Metabolism
Alternative Names
GST; Glutathione S-transferase; EC 2.5.1.18; PfGST
Species
Plasmodium falciparum
Source
Yeast
Expression Region
1-211aa
Target Protein Sequence
MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Plasmodium falciparum Glutathione S-transferase (GST) gets expressed in a yeast system, covering amino acids 1-211 of the full-length protein. The product includes an N-terminal 10xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis shows this recombinant protein achieves over 85% purity, which appears to meet high-quality standards for research applications. This product is designed strictly for research use and meets rigorous specifications for reliable experimental outcomes.

Glutathione S-transferase (GST) from Plasmodium falciparum likely plays a crucial role in how the parasite handles detoxification. The protein works by catalyzing glutathione conjugation to various substrates, which helps neutralize toxic compounds. This makes GST particularly significant for research aimed at understanding how the parasite survives and for developing potential malaria interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization and Enzyme Kinetics Studies

This recombinant P. falciparum GST can help investigate the enzymatic properties and substrate specificity of the parasite's glutathione S-transferase system. Researchers may perform in vitro enzyme assays to determine kinetic parameters like Km and Vmax using different glutathione conjugation substrates. The N-terminal His-tag makes purification and immobilization easier for detailed biochemical analysis. Studies like these could contribute to understanding the detoxification mechanisms that the malaria parasite uses.

2. Drug Resistance Mechanism Research

The protein serves as a valuable tool for investigating potential drug resistance mechanisms in P. falciparum, especially those related to oxidative stress response and xenobiotic metabolism. Researchers can examine how this GST interacts with antimalarial compounds or their metabolites in controlled in vitro experiments. Using the recombinant protein allows for standardized assays to study GST's role in parasite survival under drug pressure. This application supports preclinical research into understanding resistance pathways without needing live parasite cultures.

3. Antibody Development and Immunological Studies

The His-tagged recombinant protein works as an antigen for generating specific antibodies against P. falciparum GST in research settings. The high purity level (>85%) makes it suitable for immunization protocols and subsequent antibody characterization. Researchers can develop polyclonal or monoclonal antibodies for use in various immunoassays, Western blotting, or immunofluorescence studies. The N-terminal His-tag also allows for tag-specific detection methods and purification of protein-antibody complexes.

4. Protein-Protein Interaction Studies

The recombinant GST can be used in pull-down assays and other interaction studies to identify potential binding partners within the P. falciparum proteome or host cell proteins. The His-tag makes immobilization on metal affinity matrices easier for capturing interacting proteins from parasite lysates or infected cell extracts. Such studies may reveal novel protein networks and regulatory mechanisms involving GST in parasite biology. This application supports fundamental research into parasite cellular processes and host-pathogen interactions.

5. Comparative Enzymology and Evolution Studies

This P. falciparum GST can be used in comparative studies with GSTs from other Plasmodium species or related organisms to understand evolutionary relationships and functional divergence. Researchers may perform side-by-side enzymatic assays and structural comparisons to identify species-specific adaptations. The standardized recombinant format allows for controlled comparative experiments examining substrate preferences and catalytic efficiencies. Research like this contributes to understanding how detoxification systems evolved in parasitic organisms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin).
Protein Families
GST superfamily
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*