Recombinant Plasmodium falciparum Glutathione S-transferase (GST)

In Stock
Code CSB-YP847596PLO
Abbreviation Recombinant Plasmodium falciparum GST protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GST
Uniprot No.
Research Area
Metabolism
Alternative Names
GST; Glutathione S-transferase; EC 2.5.1.18; PfGST
Species
Plasmodium falciparum
Source
Yeast
Expression Region
1-211aa
Target Protein Sequence
MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Plasmodium falciparum Glutathione S-transferase (GST) gets expressed in a yeast system, covering amino acids 1-211 of the full-length protein. The product includes an N-terminal 10xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis shows this recombinant protein achieves over 85% purity, which appears to meet high-quality standards for research applications. This product is designed strictly for research use and meets rigorous specifications for reliable experimental outcomes.

Glutathione S-transferase (GST) from Plasmodium falciparum likely plays a crucial role in how the parasite handles detoxification. The protein works by catalyzing glutathione conjugation to various substrates, which helps neutralize toxic compounds. This makes GST particularly significant for research aimed at understanding how the parasite survives and for developing potential malaria interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant Plasmodium falciparum Glutathione S-transferase (GST, 1–211aa) expressed in yeast with an N-terminal 10×His tag represents the full-length enzyme, and yeast is a suitable eukaryotic system for expressing soluble cytosolic enzymes such as GST. Because GST is a well-folded, dimeric enzyme that does not rely on complex post-translational modifications, there is a high probability that the recombinant protein is correctly folded and enzymatically active. Yeast can produce properly folded, soluble GST with native-like activity, although this must still be experimentally verified through enzymatic assays (e.g., using CDNB substrates).

1. Biochemical Characterization and Enzyme Kinetics Studies

This recombinant P. falciparum GST can be used to study enzymatic properties and substrate specificity through in vitro assays measuring kinetic parameters such as Km and Vmax with glutathione-conjugating substrates. If the protein retains correct folding and dimerization, it should display measurable GST activity suitable for mechanistic characterization. If misfolded or partially inactive, it may still serve for qualitative substrate binding or comparative analyses, but not for accurate kinetic modeling. Thus, functional validation through enzymatic assays should precede kinetic studies.

2. Drug Resistance Mechanism Research

The recombinant GST is useful for exploring drug resistance mechanisms related to oxidative stress and detoxification in P. falciparum. Researchers can analyze how GST interacts with antimalarial compounds or their metabolites. If the enzyme is correctly folded and active, it can provide meaningful data on drug conjugation or detoxification activity. If inactive, it may still serve for binding or inhibition screening but not for functional resistance modeling. Therefore, enzymatic validation is essential to confirm its biological relevance in resistance mechanism studies.

3. Antibody Development and Immunological Studies

The His-tagged GST protein is suitable for producing P. falciparum GST-specific antibodies. The >85% purity supports consistent immunogenicity. If folded correctly, antibodies developed from this antigen may recognize both native and denatured GST in parasite samples. If misfolded, it can still generate linear-epitope antibodies, effective for Western blotting and ELISA but not necessarily for recognizing native epitopes in immunofluorescence or immunoprecipitation. Thus, it is a valid antigen, though conformational validation enhances its utility for native detection studies.

4. Protein-Protein Interaction Studies

The recombinant GST can be used to identify potential binding partners in the P. falciparum proteome or host cell extracts using pull-down or affinity capture methods. If folded correctly, its native dimeric structure will support physiologically relevant interactions. If misfolded, binding assays may still detect nonspecific or partial interactions, requiring caution in data interpretation. Therefore, results from interaction studies should be corroborated with additional biophysical or cellular assays.

5. Comparative Enzymology and Evolution Studies

The recombinant P. falciparum GST is appropriate for comparative studies with GSTs from other Plasmodium species or organisms to assess evolutionary and functional differences. If correctly folded, it enables accurate cross-species comparison of enzyme kinetics, substrate range, and catalytic efficiency. If partially misfolded, it can still contribute to structural sequence-based comparisons but not to quantitative enzymatic analyses. Folding and activity verification should be confirmed before detailed comparative studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin).
Protein Families
GST superfamily
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*