Recombinant Human Coagulation factor XI(F11),partial

In Stock
Code CSB-EP007916HU
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P03951
Lead Time 3-7 business days
Relevance Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Plasma thromboplastin antecedent Short name:PTA Cleaved into the following 2 chains: Coagulation factor XIa heavy chain Coagulation factor XIa light chain
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR
Research Area Cardiovascular
Source E.coli
Gene Names F11
Protein Names Recommended name: Coagulation factor XI Short name= FXI EC= 3.4.21.27 Alternative name(s): Plasma thromboplastin antecedent Short name= PTA Cleaved into the following 2 chains: 1. Coagulation factor XIa heavy chain 2.
Expression Region 19-387aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 45.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
Involvement in disease Factor XI deficiency (FA11D)
Subcellular Location Secreted
Protein Families Peptidase S1 family, Plasma kallikrein subfamily
Tissue Specificity Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.
Database Links

HGNC: 3529

OMIM: 264900

KEGG: hsa:2160

STRING: 9606.ENSP00000384957

UniGene: Hs.1430

Pathway Complement and coagulation cascades

Related Products

F11 Antibodies

F11 Antibodies for Homo sapiens (Human)

F11 Proteins

F11 Proteins for Homo sapiens (Human)

F11 ELISA Kit

F11 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.