Recombinant Human Coagulation factor XI (F11), partial

In Stock
Code CSB-EP007916HU
Abbreviation Recombinant Human F11 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
coagulation factor XI; Coagulation factor XIa light chain; F11; FA11_HUMAN; FXI; MGC141891; Plasma thromboplastin antecedent; Platelet coagulation factor XI ; PTA
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-387aa
Target Protein Sequence
ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human F11 protein offers an exceptional resource for researchers focusing on cardiovascular studies, specifically in the area of blood coagulation. Coagulation factor XI, also known as plasma thromboplastin antecedent (PTA), plays a vital role in the intrinsic pathway of the coagulation cascade, converting factor IX to its activated form, factor IXa.

This product presents a partial sequence of the human F11 protein (19-387aa), which is expressed in E.coli, ensuring the production of a high-quality recombinant protein. The N-terminal 6xHis tag enables seamless purification and detection in a variety of applications. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human F11 protein serves as a trustworthy reagent for your cardiovascular research. The lyophilized powder form allows for easy reconstitution and immediate use in your experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
Gene References into Functions
  1. Direct DNA sequencing analysis of the F11 genes revealed that all of the 14 patients had a F11 gene mutation. Eight different mutations were identified in the apple 1, apple 2 or serine protease domains, except one which was a splice site mutation. Six of the mutations were recurrent. PMID: 27723456
  2. The aim of the current study was to analyze, for the first time in the Portuguese population, five well known and replicated venous thromboembolism - associated single nucleotide polymorphisms in genes ABO (rs2519093 and rs8176719), F11 (rs2036914 and rs2289252) and FGG (rs2066865), and to determine its possible association with risk for venous thromboembolism. PMID: 29995659
  3. Data indicate four new factor XI (FXI) gene defects potentially causing a functional deficiency and the duplication of 1653 bp involving exons 8 and 9. PMID: 28960694
  4. In this prospective cohort of elderly adults, there was no statistically significant association of higher FXI levels with incident coronary heart disease and stroke. PMID: 28009647
  5. High molecular weight kininogen has an inhibitory effect on nucleic acid-supported fXI activation and may function as a negative regulator of fXI activation. PMID: 28124063
  6. FXI has a role in promoting a vascular coagulation-inflammatory circuit in arterial hypertension PMID: 28148841
  7. thrombin activatable fibrinolysis inhibitor pathway impairment, largely caused by a hitherto unknown TAFIa resistance, appears to be one main cause of decreased fibrinolytic resistance in FXI deficiency PMID: 27094709
  8. factor XI has a role in procoagulant microparticle-promoted coagulation in human endotoxemia PMID: 26857798
  9. Three loci showed robust, replicating association with circulating FXI levels: KNG1 (rs710446, P-value = 2.07 x 10-302), F11 (rs4253417, P-value = 2.86 x 10-193), and a novel association in GCKR (rs780094, P-value = 3.56 x10-09), here for the first time implicated in FXI regulation. The two first SNPs (rs710446 and rs4253417) also associated with partial thromboplastin time PMID: 28053049
  10. The rs710446 and five low-frequency variant sets in KNG1 with FXI level variation of Factor XI were significant after multiple testing correction and permutation. PMID: 28445521
  11. Exploring the global landscape of genetic variation in coagulation factor XI deficiency PMID: 28615222
  12. Structures of FXI in complex with the laminin-derived peptide EFPDFP and a DFP peptide from the random screen demonstrated binding in the same pocket, although in a slightly different conformation, thus revealing some flexibility in the molecular interactions of the FXI apple 2 domain. PMID: 27006387
  13. inhibition of FXI and FXII distinctly alter the biophysical properties of fibrin. PMID: 27933406
  14. Data show that among the studied polymorphisms, only coagulation factor XI (F11) single nucleotide polymorphism rs2289252 was significantly associated with venous thrombosis (VT) and the F11 rs2289252-A allele was associated with a 1.6-fold increased risk of VT PMID: 27414984
  15. Thus in conclusion, the bleeding manifestations in FXI deficiency are varied and unpredictable; neither correlates with FXI levels nor with the mutations. Comprehensive analysis of all the factors including both plasma and platelet FXI, global hemostatic factors like thrombin generation potential may indicate a potential laboratory indicator for FXI deficiency related bleeding manifestations. PMID: 27710856
  16. Fasudil reduced LPS-mediated TF and PAI-1 expression and activity in PBMCs. These effects may partially be relevant to the clinical benefits of fasudil in the treatment of CAPD patients. PMID: 27756191
  17. rs2289252 and rs2036914 polymorphisms have important role in development of venous thromboembolism in the white race PMID: 28353616
  18. High activity of factor XI indicates a risk of occurrence of deep vein thrombosis in post-trauma patients with fractures. F11 rs2089252 and rs2036914 (single nucleotide polymorphisms) are associated with activity of factors XI in such patients despite prophylaxis. PMID: 27627722
  19. this study confirms the significant associations between polymorphism of 25264C.T in FXI and its activity and the risk of deep vein thrombosis after artificial joint replacement surgery PMID: 26934731
  20. F11 genetic variants are associated with the risk of incident venous thrombosis among women PMID: 26631918
  21. This study characterized FXI deficiency mutation spectrum in Chinese population with a high frequency of the W228*, G400V, Q263* and c.1136-4delGTTG mutations, which is distinct from that of other populations including Korean, Jewish or European populations. PMID: 27067486
  22. factor XI is localized to GPIb in membrane rafts and that this association is important for promoting the activation of factor XI by thrombin on the platelet surface PMID: 12517745
  23. higher basal factor XI concentration in the general population is not a risk marker for stroke or coronary heart disease PMID: 26386215
  24. Factor XI and factor XII activities were significantly higher in patients with slow coronary flow than in controls, and could be associated with enhanced procoagulant state present in these patients. PMID: 24509324
  25. FXI-thrombin axis contributes to distal platelet activation and procoagulant microaggregate formation in the blood flow downstream of the site of thrombus formation. PMID: 26769048
  26. F11 gene variant rs2289252 contributes to inherited forms of deep vein thrombosis incidence in Latvian population. PMID: 25091233
  27. These studies enhance understanding on the first allosteric inhibitor of FXIa and highlight its value as a promising anticoagulant. PMID: 25935648
  28. ROTEM assays failed to distinguish bleeding from non-bleeding patients but could do so between different FXI activity levels and genotypes. PMID: 26160656
  29. increased activity of FXI may be a potential risk factor for miscarriage; high activity of FXI diagnosed in women with history of miscarriage is not probably caused by the presence of SNPs rs2289252 and rs2036914 PMID: 25517908
  30. Data indicate that the mean factor XI (FXI) was not significantly different in laboratories using the same method on both exercises, suggesting good intralaboratory precision over time. PMID: 25976967
  31. Identification of a novel c.290G>A mutation in the F11 gene that is associated with mild Factor XI deficiency in a Dutch Caucasian family. PMID: 25618263
  32. In whites, the FXI variant was associated with both factor XI concentration and venous thromboembolism (VTE) incidence (1.15-fold greater incidence of VTE per risk allele), whereas In African-Americans, these associations were absent. PMID: 26260105
  33. Mass spectrometry analyses of FXI revealed full occupation of two of the three heavy-chain glycosites and almost full-site occupancy of the light chain. Analysis of FXI glycopeptides by LC-MS/MS enabled site-specific glycan profiling and occupancy. PMID: 25092234
  34. This study presents the first application of a new thrombin generation based factor XIa assay. PMID: 25288467
  35. study determined the molecular basis of FXI deficiency in 6 unrelated severely deficient patients in China; reported 8 mutations in FXI gene leading to FXI deficiency; functional consequences of a novel mutation leading to FXI deficiency have been elucidated PMID: 25681615
  36. FXI expression is directly regulated by a specific miRNA, miR-181a-5p, in the human liver PMID: 25379760
  37. FXI may have a role in risk of ischemic stroke, but not myocardial infarct; FXII and prekallikrein may not have a role in either PMID: 24977287
  38. We suggested that the minor allele of rs3756008 in the promoter of FXI gene could reduce its expression in kidney. PMID: 24420855
  39. at variance with other populations, no single major founder effect is present in Italian patients with FXI deficiency. PMID: 24112640
  40. Genetic variants of coagulation factor XI show association with ischemic stroke up to 70 years of age. PMID: 24086496
  41. Identification of a novel candidate F11 gene mutation associated with a cross-reacting material positive plasma FXI deficiency. PMID: 23571684
  42. Studies indicate that in the past two decades, more than 220 mutations in the factor XI (FXI) gene have been reported in patients with FXI deficiency, of which 7 showed a founder effect. PMID: 23929304
  43. a novel mutations in family with inherited factor XI deficiency PMID: 23494098
  44. Propose that long polyphosphates promote FXII-mediated blood coagulation bypassing FXI. PMID: 23659638
  45. The rather rare type I mutation in the FXI gene is a third founder mutation in Ashkenazi Jews with factor XI deficiency. PMID: 23332144
  46. For activation by thrombin, or during autoactivation, the data support a cis-activation mechanism in which the activating protease binds to and activates the same fXI subunit. PMID: 23515926
  47. F11 gene mutational screening revealed 11 different DNA variations, 3 of which had not yet been described PMID: 23305485
  48. Factor XI is a substrate for oxidoreductases: enhanced activation of reduced FXI is found in antiphospholipid syndrome thrombosis. PMID: 22704541
  49. A novel amino acid substitution in the serine protease catalytic domain (Ile463Ser) appears to be responsible for the congenital factor XI deficiency in a Swiss family. PMID: 22322133
  50. The F11 rs2289252 polymorphism is associated with FXI activity levels and APTT ratio in women with thrombosis. PMID: 22633531

Show More

Hide All

Involvement in disease
Factor XI deficiency (FA11D)
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Plasma kallikrein subfamily
Tissue Specificity
Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.
Database Links

HGNC: 3529

OMIM: 264900

KEGG: hsa:2160

STRING: 9606.ENSP00000384957

UniGene: Hs.1430

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*