Recombinant Human Transforming growth factor beta-1(TGFB1),partial

Product Type Recombinant Protein
Uniprot No. P01137
Species Homo sapiens (Human)
Gene Names TGFB1
Protein Names Recommended name: Transforming growth factor beta-1 Short name= TGF-beta-1Cleaved into the following chain: 1. Latency-associated peptide Short name= 2. LAP
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP)
Involvement in disease Camurati-Engelmann disease (CAEND)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families TGF-beta family
Tissue Specificity Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage.
Database Links

HGNC: 11766

OMIM: 131300

KEGG: hsa:7040

STRING: 9606.ENSP00000221930

UniGene: Hs.645227

Pathway Hippo signaling pathway
MAPK signaling pathway
TGF-beta signaling pathway
Cell cycle
Cellular senescence
Osteoclast differentiation
Th17 cell differentiation
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Human Transforming growth factor beta-1(TGFB1),partial,Yeast
Code CSB-YP023446HU
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Expression Region 279-390
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Transforming growth factor beta-1(TGFB1),partial,E.coli
Code CSB-EP023446HU
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Expression Region 279-390
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Transforming growth factor beta-1(TGFB1),partial,Baculovirus
Code CSB-BP023446HU
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Expression Region 279-390
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Transforming growth factor beta-1(TGFB1),partial,Mammalian cell
Code CSB-MP023446HU
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Expression Region 279-390
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

Q&A
Q:

Could you answer the following for CSB-YP023446HU?
1. What is the size (KD) of this protein?
2. Is it in the dimer form or monomer form?
3. Can the his-tag be removed?
4. Quote please.

A:
Very nice to receive your inquiry.
1) Molecular Weight: 14KD
2) It is in the monomer form.
3) We could try to remove the tag but can't guarantee 100% success. If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for any extra cost.
4) See the quotation above.
We have another fragment to recommend to the customer.
Customer Reviews

Related Products

TGFB1 Antibodies

TGFB1 Antibodies for Homo sapiens (Human)

TGFB1 Antibodies for Human

TGFB1 Proteins

TGFB1 Proteins for Homo sapiens (Human)

TGFB1 ELISA Kit

TGFB1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.