Recombinant Human Transforming growth factor beta-1(TGFB1),partial

Code CSB-EP023446HU1
Product Type Recombinant Protein
Size US$1726
Uniprot No. P01137
Relevance Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone rodeling as it is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Research Area Signal Transduction
Source E.coli
Gene Names TGFB1
Expression Region 281-390aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP)
Involvement in disease Camurati-Engelmann disease (CAEND)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families TGF-beta family
Tissue Specificity Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage.
Database Links

HGNC: 11766

OMIM: 131300

KEGG: hsa:7040

STRING: 9606.ENSP00000221930

UniGene: Hs.645227

Pathway Hippo signaling pathway
MAPK signaling pathway
TGF-beta signaling pathway
Cell cycle
Cellular senescence
Osteoclast differentiation
Th17 cell differentiation
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway

Related Products

TGFB1 Antibodies

TGFB1 Antibodies for Homo sapiens (Human)

TGFB1 Antibodies for Human

TGFB1 Proteins

TGFB1 Proteins for Homo sapiens (Human)

TGFB1 ELISA Kit

TGFB1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.