Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP003861HU |
| Product Type | Growth Factor |
| Size |
$137Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P01137 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm Filtered 50mM Glycine, 50mM NaCl, pH4.0 |
| Alias | Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 0.2 ng/ml |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Research Area | Cancer |
| Source | Mammalian cell |
| Gene Names | TGFB1 |
| Expression Region | 279-390aa |
| Tag Info | Tag-Free |
| Mol. Weight | 12.8 kDa |
| Protein Description | Full Length of Mature Protein |
| References |
|
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) |
| Involvement in disease | Camurati-Engelmann disease (CAEND) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | TGF-beta family |
| Tissue Specificity | Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage. |
| Database Links |
HGNC: 11766 OMIM: 131300 KEGG: hsa:7040 STRING: 9606.ENSP00000221930 UniGene: Hs.645227 |
| Pathway |
Hippo signaling pathway
MAPK signaling pathway TGF-beta signaling pathway Cell cycle Cellular senescence Osteoclast differentiation Th17 cell differentiation AGE-RAGE signaling pathway in diabetic complications FoxO signaling pathway |
TGFB1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA023446GA01HU | TGFB1 Antibody | Human,Mouse,Rat | ELISA,IHC |
| CSB-PA786987 | TGFB1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA004279 | TGFB1 Antibody | Human,Mouse,Rat | WB,IHC,IF,ELISA |
| CSB-PA080233 | TGFB1 Antibody | Human,Mouse,Rat | WB,IHC |
| CSB-PA080237 | TGFB1 Antibody | Human,Mouse,Rat | WB |
| CSB-PA697937 | TGFB1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA060587 | TGFB1 Antibody | Human,Mouse,Rat | ELISA,IHC |
TGFB1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA07309B0Rb | TGFB1 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA07309C0Rb | TGFB1 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA07309D0Rb | TGFB1 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA07309A0Rb | TGFB1 Antibody | Human | ELISA, IHC |
TGFB1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP023446HU CSB-EP023446HU CSB-BP023446HU CSB-MP023446HU |
Recombinant Human Transforming growth factor beta-1(TGFB1),partial | Yeast E.coli Baculovirus Mammalian cell |
| CSB-EP023446HU1 | Recombinant Human Transforming growth factor beta-1(TGFB1),partial | E.coli |
TGFB1 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E04725h | Human Transforming Growth factor β1,TGF-β1 ELISA kit | serum, plasma, cell culture supernates | 0.747 ng/mL |
Recombinant Aequorea victoria Green fluorescent protein(GFP)
Express system: E.coli
Species: Aequorea victoria (Jellyfish)
Recombinant Mouse Hyaluronan synthase 2(Has2),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Mouse E3 ubiquitin-protein ligase Mdm2(Mdm2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Glycogen synthase kinase-3 beta(GSK3B)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Cyclin-dependent kinase 4 inhibitor D(CDKN2D)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Keratin, type II cytoskeletal 7(KRT7)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
