Recombinant Human Transforming growth factor beta-1(TGFB1),partial (Active)

^{In Stock}

Code	CSB-AP003861HU
Size	$137Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details
Citations
Related Products
Target Data

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 0.2 ng/ml
Target Names	TGFB1
Uniprot No.	P01137
Research Area	Cancer
Alternative Names	Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	279-390aa
Complete Sequence	ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Mol. Weight	12.8 kDa
Protein Length	Partial
Tag Info	Tag-Free
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm Filtered 50 mM Glycine, 150 mM NaCl, pH 2.5
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Citations

miR‑877‑3p promotes TGF‑β1‑induced osteoblast differentiation of MC3T3‑E1 cells by targeting Smad7. Guisong He,Experimental and Therapeutic Medicine,2019

Applications: Stem/immune cell maintenance or differentiation
Species: Mouse
Review: TGF- β 1 promotes the osteoblastic differentiation of MC3T3-E1 cells. (A) RT-qPCR analysis of the osteogenic-related genes RUNX2, OSX and COL1A1 in MC3T3-E1 cells after treatment with TGF- β 1 (4 ng/ml) for 0, 7 and 14 days. (B) Western blotting of RUNX2, COL1A1‑and OSX protein in MC3T3-E1 cells cultured with TGF- β 1 (4 ng/ml) for 0, 7 and 14 days. (C) ALP activity in MC3T3‑E1 cells after treatment with TGF‑ β 1 (4 ng/ml) for 0, 7 and 14 days. NS, no significance change; ^* P<0.05, ^**P<0.01 as indicated. TGF, transforming growth factor; RUNX2, runt-related transcription factor 2; OSX, osterix; COL1A1 collagen type I α 1 chain; ALP, alkaline phosphatase.

Target Data

Function	Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP)
Involvement in disease	Camurati-Engelmann disease (CAEND)
Subcellular Location	Secreted, extracellular space, extracellular matrix
Protein Families	TGF-beta family
Tissue Specificity	Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage.
Database Links	HGNC: 11766 OMIM: 131300 KEGG: hsa:7040 STRING: 9606.ENSP00000221930 UniGene: Hs.645227