Recombinant Human Transforming growth factor beta-1(TGFB1),partial (Active)

In Stock
Code CSB-AP003861HU
Size $137Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 0.2 ng/ml
Target Names TGFB1
Uniprot No. P01137
Research Area Cancer
Alternative Names Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 279-390aa
Complete Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Mol. Weight 12.8 kDa
Protein Length Partial
Tag Info Tag-Free
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm Filtered 50 mM Glycine, 150 mM NaCl, pH 2.5
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Citations

miR‑877‑3p promotes TGF‑β1‑induced osteoblast differentiation of MC3T3‑E1 cells by targeting Smad7. Guisong He,Experimental and Therapeutic Medicine,2019

Applications: Stem/immune cell maintenance or differentiation
Species: Mouse
Review: TGF- β 1 promotes the osteoblastic differentiation of MC3T3-E1 cells. (A) RT-qPCR analysis of the osteogenic-related genes RUNX2, OSX and COL1A1 in MC3T3-E1 cells after treatment with TGF- β 1 (4 ng/ml) for 0, 7 and 14 days. (B) Western blotting of RUNX2, COL1A1‑and OSX protein in MC3T3-E1 cells cultured with TGF- β 1 (4 ng/ml) for 0, 7 and 14 days. (C) ALP activity in MC3T3‑E1 cells after treatment with TGF‑ β 1 (4 ng/ml) for 0, 7 and 14 days. NS, no significance change; * P<0.05, ** P<0.01 as indicated. TGF, transforming growth factor; RUNX2, runt-related transcription factor 2; OSX, osterix; COL1A1 collagen type I α 1 chain; ALP, alkaline phosphatase.

Target Data

Function Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP)
Involvement in disease Camurati-Engelmann disease (CAEND)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families TGF-beta family
Tissue Specificity Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage.
Database Links

HGNC: 11766

OMIM: 131300

KEGG: hsa:7040

STRING: 9606.ENSP00000221930

UniGene: Hs.645227

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.