Code | CSB-AP003861HU |
Size |
InquiryPurchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 human erythroleukemic cells is less than 0.2 ng/ml |
Target Names | TGFB1 |
Uniprot No. | P01137 |
Research Area | Cancer |
Alternative Names | Cartilage-inducing factor; CED; Differentiation inhibiting factor; DPD1; LAP; Latency-associated peptide; Prepro transforming growth factor beta 1; TGF beta 1; TGF beta; TGF beta 1 protein; TGF-beta 1 protein; TGF-beta-1; TGF-beta-5; TGF-beta1; TGFB; Tgfb-1; tgfb1; TGFB1_HUMAN; TGFbeta; TGFbeta1; Transforming Growth Factor b1; Transforming Growth Factor beta 1; Transforming growth factor beta 1a; transforming growth factor beta-1; transforming growth factor, beta 1; Transforming Growth Factor-脽1 |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 279-390aa |
Complete Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Mol. Weight | 12.8 kDa |
Protein Length | Partial |
Tag Info |
Tag-Free |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm Filtered 50mM Glycine-HCl, 150mMNacl, pH2.5 |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Datasheet & COA | Please contact us to get it. |
Applications : Stem/immune cell maintenance or differentiation
Review: TGF- β 1 promotes the osteoblastic differentiation of MC3T3-E1 cells. (A) RT-qPCR analysis of the osteogenic-related genes RUNX2, OSX and COL1A1 in MC3T3-E1 cells after treatment with TGF- β 1 (4 ng/ml) for 0, 7 and 14 days. (B) Western blotting of RUNX2, COL1A1‑and OSX protein in MC3T3-E1 cells cultured with TGF- β 1 (4 ng/ml) for 0, 7 and 14 days. (C) ALP activity in MC3T3‑E1 cells after treatment with TGF‑ β 1 (4 ng/ml) for 0, 7 and 14 days. NS, no significance change; * P<0.05, ** P<0.01 as indicated. TGF, transforming growth factor; RUNX2, runt-related transcription factor 2; OSX, osterix; COL1A1 collagen type I α 1 chain; ALP, alkaline phosphatase.
By Anonymous
Function |
Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively.; Required to maintain the Transforming growth factor beta-1 (TGF-beta-1) chain in a latent state during storage in extracellular matrix. Associates non-covalently with TGF-beta-1 and regulates its activation via interaction with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS, that control activation of TGF-beta-1. Interaction with LRRC33/NRROS regulates activation of TGF-beta-1 in macrophages and microglia (Probable). Interaction with LRRC32/GARP controls activation of TGF-beta-1 on the surface of activated regulatory T-cells (Tregs). Interaction with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) results in distortion of the Latency-associated peptide chain and subsequent release of the active TGF-beta-1.; Multifunctional protein that regulates the growth and differentiation of various cell types and is involved in various processes, such as normal development, immune function, microglia function and responses to neurodegeneration. Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains remain non-covalently linked rendering TGF-beta-1 inactive during storage in extracellular matrix. At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS that control activation of TGF-beta-1 and maintain it in a latent state during storage in extracellular milieus. TGF-beta-1 is released from LAP by integrins (ITGAV:ITGB6 or ITGAV:ITGB8): integrin-binding to LAP stabilizes an alternative conformation of the LAP bowtie tail and results in distortion of the LAP chain and subsequent release of the active TGF-beta-1. Once activated following release of LAP, TGF-beta-1 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal. While expressed by many cells types, TGF-beta-1 only has a very localized range of action within cell environment thanks to fine regulation of its activation by Latency-associated peptide chain (LAP) and 'milieu molecules'. Plays an important role in bone remodeling: acts as a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP). Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus. Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types.
|
Gene References into Functions |
|
Involvement in disease | Camurati-Engelmann disease (CAEND) |
Subcellular Location | [Latency-associated peptide]: Secreted, extracellular space, extracellular matrix.; [Transforming growth factor beta-1]: Secreted. |
Protein Families | TGF-beta family |
Tissue Specificity | Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage. |
Database Links |
HGNC: 11766 OMIM: 131300 KEGG: hsa:7040 STRING: 9606.ENSP00000221930 UniGene: Hs.645227 |