Recombinant Mouse Ornithine transcarbamylase, mitochondrial (Otc)

In Stock
Code CSB-EP017270MO
Abbreviation Recombinant Mouse Otc protein
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Otc; Ornithine carbamoyltransferase; mitochondrial; EC 2.1.3.3; Ornithine transcarbamylase; OTCase
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
33-354aa
Target Protein Sequence
SQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Mouse Otc was expressed with the amino acid range of 33-354. The calculated molecular weight for this Otc protein is 52.1 kDa. This Otc protein is produced using e.coli expression system. The Otc coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant Otc protein in following stages of expression and purification.

The mouse ornithine transcarbamylase, mitochondrial (Otc) is an essential enzyme involved in the urea cycle, a metabolic pathway that facilitates the detoxification of ammonia, a byproduct of protein metabolism. Otc catalyzes the conversion of ornithine and carbamoyl phosphate into citrulline, a crucial step in the urea cycle. This process occurs within the mitochondria of liver cells and is vital for maintaining nitrogen balance in the body. Dysfunction of Otc can lead to hyperammonemia, a condition characterized by elevated ammonia levels, which can be toxic to the central nervous system. Research related to Otc primarily focuses on understanding its role in the urea cycle, exploring potential therapeutic interventions for urea cycle disorders, and investigating its broader implications in metabolic regulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the second step of the urea cycle, the condensation of carbamoyl phosphate with L-ornithine to form L-citrulline. The urea cycle ensures the detoxification of ammonia by converting it to urea for excretion.
Gene References into Functions
  1. Gene correction in adult OTC-deficient mice was lower and accompanied by larger deletions that ablated residual expression from the endogenous OTC gene, leading to diminished protein tolerance and lethal hyperammonemia on a chow diet PMID: 26829317
  2. The corresponding OTC tissue enzyme activities were between 3-6% of normal control in mouse and human liver. The use of the cryptic splice sites was reproduced in minigenes carrying murine or human mutant sequences PMID: 25853564
  3. Serum OCT seemed to reflect tumor necrosis factor-alpha-mediated hepatic damage in diabetic obese mice and could be useful in the application for non-alcoholic fatty liver disease with features of metabolic syndrome, such as obesity and diabetes. PMID: 19793175
  4. in vivo regulation by HNF4alpha PMID: 11994307
  5. Results highlight the importance of the interaction between the OTC spf-ash mutation (ornithine transcarbamylase deficiency) and genetic backgrounds on metabolic phenotypes (ureagenesis, arginine metabolism, and nitric oxide production). PMID: 17925451
  6. Phenotypic correction of OTC deficiency using low-dose helper-dependent adenoviral vectors is reported. PMID: 18563850
  7. Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals. PMID: 19318352

Show More

Hide All

Involvement in disease
Defects in Otc are the cause of the Sparse fur (spf) phenotype. Spf mouse have an OTCase with an overall decrease in activity, and altered substrate affinity.
Subcellular Location
Mitochondrion matrix.
Protein Families
ATCase/OTCase family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*