Home
Protein
Recombinant Protein
Recombinant Mouse Ornithine transcarbamylase, mitochondrial (Otc)

Recombinant Mouse Ornithine transcarbamylase, mitochondrial (Otc)

^{In Stock}

Code	CSB-EP017270MO
MSDS	MSDS
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Otc

Uniprot No.

P11725

Research Area

Others

Alternative Names

Otc; Ornithine carbamoyltransferase; mitochondrial; EC 2.1.3.3; Ornithine transcarbamylase; OTCase

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

33-354aa

Target Protein Sequence

SQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

52.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Mouse Otc was expressed with the amino acid range of 33-354. The calculated molecular weight for this Otc protein is 52.1 kDa. This Otc protein is produced using e.coli expression system. The Otc coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant Otc protein in following stages of expression and purification.

The mouse ornithine transcarbamylase, mitochondrial (Otc) is an essential enzyme involved in the urea cycle, a metabolic pathway that facilitates the detoxification of ammonia, a byproduct of protein metabolism. Otc catalyzes the conversion of ornithine and carbamoyl phosphate into citrulline, a crucial step in the urea cycle. This process occurs within the mitochondria of liver cells and is vital for maintaining nitrogen balance in the body. Dysfunction of Otc can lead to hyperammonemia, a condition characterized by elevated ammonia levels, which can be toxic to the central nervous system. Research related to Otc primarily focuses on understanding its role in the urea cycle, exploring potential therapeutic interventions for urea cycle disorders, and investigating its broader implications in metabolic regulation.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the second step of the urea cycle, the condensation of carbamoyl phosphate with L-ornithine to form L-citrulline. The urea cycle ensures the detoxification of ammonia by converting it to urea for excretion.

Gene References into Functions

Gene correction in adult OTC-deficient mice was lower and accompanied by larger deletions that ablated residual expression from the endogenous OTC gene, leading to diminished protein tolerance and lethal hyperammonemia on a chow diet PMID: 26829317
The corresponding OTC tissue enzyme activities were between 3-6% of normal control in mouse and human liver. The use of the cryptic splice sites was reproduced in minigenes carrying murine or human mutant sequences PMID: 25853564
Serum OCT seemed to reflect tumor necrosis factor-alpha-mediated hepatic damage in diabetic obese mice and could be useful in the application for non-alcoholic fatty liver disease with features of metabolic syndrome, such as obesity and diabetes. PMID: 19793175
in vivo regulation by HNF4alpha PMID: 11994307
Results highlight the importance of the interaction between the OTC spf-ash mutation (ornithine transcarbamylase deficiency) and genetic backgrounds on metabolic phenotypes (ureagenesis, arginine metabolism, and nitric oxide production). PMID: 17925451
Phenotypic correction of OTC deficiency using low-dose helper-dependent adenoviral vectors is reported. PMID: 18563850
Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals. PMID: 19318352

Hide All

Involvement in disease

Defects in Otc are the cause of the Sparse fur (spf) phenotype. Spf mouse have an OTCase with an overall decrease in activity, and altered substrate affinity.

Subcellular Location

Mitochondrion matrix.

Protein Families

ATCase/OTCase family

Database Links

KEGG: mmu:18416

STRING: 10090.ENSMUSP00000056152

UniGene: Mm.2611

Promotions