Recombinant Human T-cell antigen CD7 (CD7), partial (Active)

In Stock
Code CSB-MP004953HU
Abbreviation Recombinant Human CD7 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1 (CSB-MP819898HU), the EC50 is 1.236-1.773 ng/ml. Biological Activity Assay
  • Activity
    Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay. Biological Activity Assay
  • The purity of CD7 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity
Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1 (CSB-MP819898HU), the EC50 is 1.236-1.773 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Target Names
Uniprot No.
Alternative Names
(GP40)(T-cell leukemia antigen)(T-cell surface antigen Leu-9)(TP41)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26-180aa
Target Protein Sequence
AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Mol. Weight
46.5 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human CD7 protein is expressed in mammalian cells using a plasmid carrying the target gene. The target gene encodes the 26-180aa of the human CD7 protein. The target gene is also labeled with a C-terminal hFc-Myc-tag gene. The resulting recombinant CD7 protein's purity is over 90% as measured by SDS-PAGE. The SEC-HPLC determines its purity exceeding 95%. Its endotoxin level is less than 1.0 EU/μg as accessed by the LAL method. Its biological activity is verified via ELISA, where this human CD7 protein specifically binds to the SECTM1 (CSB-MP819898HU) with an EC50 ranging from 1.236 to 1.773 ng/mL. In the LSPR assay, this CD7 protein captured on the COOH chip binds to the human SECTM1 protein (CSB-MP819898HU) with an affinity constant of 1.84 nM.

Human CD7 is a cell surface glycoprotein primarily expressed on T cells, NK cells, and some hematopoietic progenitor cells. It plays a significant role in the immune system, particularly in T lymphocytes. It is involved in various cellular processes, including T-cell activation, differentiation, and apoptosis. The expression of CD7 is notably high in T-cell acute lymphoblastic leukemia (T-ALL), making it an attractive target for therapeutic interventions. Research has shown that CD7 is expressed on the majority of T-ALL cells, as well as on leukemia-initiating cells, which underscores its potential as a target for antibody-drug conjugates and other immunotherapeutic strategies [1].

CD7 is also involved in signaling pathways that influence T-cell behavior. CD7 activation has been shown to deliver pro-apoptotic signals during galectin-1-induced T cell death, indicating its involvement in regulating T cell survival and apoptosis [2]. Additionally, CD7 interacts with SECTM1, a ligand that can activate the PI3K signaling pathway in monocytes, further illustrating its role in immune cell signaling [3]. This interaction is particularly relevant in the context of systemic sclerosis, where CD7 activation is associated with enhanced cytotoxic responses [4].

References:
[1] J. Zhang, A. Jain, S. Milhas, D. Williamson, J. Mysliwy, A. Lodge, et al. An antibody-drug conjugate with intracellular drug release properties showing specific cytotoxicity against cd7-positive cells, Leukemia Research, vol. 108, p. 106626, 2021. https://doi.org/10.1016/j.leukres.2021.106626
[2] K. Pace, H. Hahn, M. Pang, J. Nguyen, & L. Baum. Cutting edge: cd7 delivers a pro-apoptotic signal during galectin-1-induced t cell death, The Journal of Immunology, vol. 165, no. 5, p. 2331-2334, 2000. https://doi.org/10.4049/jimmunol.165.5.2331
[3] T. Wang, Y. Ge, M. Xiao, A. López-Coral, L. Li, A. Roesch, et al. Sectm1 produced by tumor cells attracts human monocytes via cd7-mediated activation of the pi3k pathway, Journal of Investigative Dermatology, vol. 134, no. 4, p. 1108-1118, 2014. https://doi.org/10.1038/jid.2013.437
[4] T. Papadimitriou. Cd7 activation regulates cytotoxicity-driven pathology in systemic sclerosis, yielding a target for selective cell depletion, Annals of the Rheumatic Diseases, vol. 83, no. 4, p. 488-498, 2023. https://doi.org/10.1136/ard-2023-224827

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
4.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: I used the CSB-MP004953HU product for an ELISA experiment, and CD7 was detected at 5 μg/ml can bind to human SECTM1, with an EC50 of 1.811-3.372ng/ml. The protein has good binding activity and can be used for my future research and application. It has excellent repeatability, and is convenient to purchase at a favorable price. I plan to purchase in large quantities in the future!

By Anonymous

Target Background

Function
Not yet known.
Gene References into Functions
  1. in acute myeloid leukemia patients the association of CD7 positivity and FLT3 positivity was found to be significant PMID: 25679063
  2. Data show that CD7 promotes extramedullary involvement of the B-ALL line Tanoue in an integrin beta2-dependent manner. PMID: 24920488
  3. We showed that the CADM1 versus CD7 plot is capable of discriminating clonally expanding HTLV-I-infected cells in indolent and acute-type T-cell leukemia-lymphomas and in asymptomatic carriers PMID: 24727323
  4. CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues PMID: 24157461
  5. SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells. PMID: 24211252
  6. epigenetic down-regulation of CD7 is associated with acute myeloid leukemia. PMID: 20398252
  7. CD7 loss in aggressive natural killer-cell leukemia; a useful diagnostic marker PMID: 20046078
  8. low expression in T-cell lymphomas due to Twist2-mediated suppression of promoter activity; enhanced by histone deacetylase inhibitors PMID: 19937140
  9. These findings indicate a link between epigenetic modifications and CD7 expression in primitive chronic myeloid leukemia cells. PMID: 20175919
  10. CD7 expression in hematopoitic cells denotes commitment to B-cell and natural killer cells lineages. PMID: 12393702
  11. Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover. PMID: 12594831
  12. a novel fusion protein, designated scFvCD7:sFasL is designed to have leukemia-restricted activity. PMID: 16332967
  13. Patients expressing CD7 had significant shorter disease free (DFS) and post-remission survivals (PRS) than patients without CD7 (DFS of 12 months versus 42 months, P=0.005; PRS of 15 months versus 33 months, P=0.013). PMID: 16837044
  14. CD7 antigen notably expresses in lung microvascular endothelial cells (LME) and that it acts as an Fc receptor for IgM in LME cells. PMID: 16990185
  15. HTLV-IInfected cells acquired a profound decrease of intracellular calcium levels in response to ionomycin, timely correlated with decreased CD7 expression PMID: 17287851
  16. differential levels of CD7 identify the progressive stages of lineage commitment in human thymus, initiated from a primitive CD7(-) lympho-myeloid thymic progenitor PMID: 17959857
  17. close association of aberrant CD7 expression and FLT3/ITD mutation in the myeloblasts of FLT3/ITD+ acute myeloid leukemia suggests that FLT3/ITD- mediated leukemic transformation occurs in the more early stage of myeloid progenitor cells PMID: 18343790
  18. The CD7 expression in CD4(+) T cells discriminates between HL and reactive LAD, suggesting that this could be a useful and practical adjunctive tool in the diagnosis of Hodgkin lymphoma. PMID: 18956470
  19. by down-regulating CD7, ATLL cells could have escaped Gal-3-induced apoptosis to run a more aggressive clinical course PMID: 19207946
  20. the galectin-1 glycoprotein receptor CD7 maybe a novel target for GdA on T cells. PMID: 19683346

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 1695

OMIM: 186820

KEGG: hsa:924

STRING: 9606.ENSP00000312027

UniGene: Hs.36972

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*