Code | CSB-MP004953HU |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
CUSABIO's product CSB-MP004953HU is a recombinant human T-cell antigen CD7. It is produced by the expression of the DNA fragment corresponding to 26-180 AA of the human CD7 protein in mammalian cells. This CD7 protein is fused with a hFc-Myc-tag at the C-terminus. It has been validated to be active through the functional ELISA (bind to the SECTM1, EC50 is 1.236-1.773 ng/ml) and LSPR assay (bind to human SECTM1 protein with an affinity constant of 1.84 nM). The purity of this CD7 protein is greater than 94.5% measured by SDS-PAGE. It contains less endotoxin, <1.0 EU/ug determined by the LAL method. And it is available now. CD7 is a cell surface costimulatory molecule expressed on T and NK cells and on cells in the early stages of T-, B-, and myeloid cell differentiation. CD7 binding to its ligand K12/SECTM1 plays a costimulatory role in T-cell activation. |
Purity | Greater than 94.5% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1 (CSB-MP819898HU), the EC50 is 1.236-1.773 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay. |
Target Names | CD7 |
Uniprot No. | P09564 |
Alternative Names | (GP40)(T-cell leukemia antigen)(T-cell surface antigen Leu-9)(TP41) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 26-180aa |
Target Protein Sequence | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
Mol. Weight | 46.5 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-Myc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Not yet known.
|
Gene References into Functions |
|
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database Links |
HGNC: 1695 OMIM: 186820 KEGG: hsa:924 STRING: 9606.ENSP00000312027 UniGene: Hs.36972 |