Name: Recombinant Human T-cell antigen CD7 (CD7), partial (Active)
Brand: CUSABIO
SKU: CSB-MP004953HU
Price: $138 USD
Availability: InStock
Rating: 4.0 (1 reviews)

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1 (CSB-MP819898HU), the EC₅₀ is 1.236-1.773 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.

Target Names

CD7

Uniprot No.

P09564

Alternative Names

(GP40)(T-cell leukemia antigen)(T-cell surface antigen Leu-9)(TP41)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

26-180aa

Target Protein Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Mol. Weight

46.5 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-Myc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD7 is a transmembrane glycoprotein expressed on T cells and NK cells that engages SECTM1 to modulate immune costimulatory signaling, making precise characterization of this interaction critical for immunotherapy research. This recombinant human CD7 construct covers the extracellular domain (aa 26–180) and is produced in mammalian cells with a C-terminal hFc1-Myc tag, preserving native glycosylation and conformational integrity essential for ligand recognition. LSPR analysis confirms high-affinity binding to SECTM1 with a KD of 1.84 nM, while functional ELISA demonstrates dose-dependent interaction with an EC50 of 1.236–1.773 ng/ml—data that supports use in receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and affinity characterization by SPR or BLI. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and therapeutic antibody epitope mapping workflows.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

4.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: I used the CSB-MP004953HU product for an ELISA experiment, and CD7 was detected at 5 μg/ml can bind to human SECTM1, with an EC50 of 1.811-3.372ng/ml. The protein has good binding activity and can be used for my future research and application. It has excellent repeatability, and is convenient to purchase at a favorable price. I plan to purchase in large quantities in the future!

By Anonymous

Code	CSB-MP004953HU
Abbreviation	Recombinant Human CD7 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1 (CSB-MP819898HU), the EC₅₀ is 1.236-1.773 ng/ml. Biological Activity Assay Activity Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay. Biological Activity Assay The purity of CD7 was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human T-cell antigen CD7 (CD7), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage