Recombinant Human Insulin-like Growth factor-1(IGF1),partial (Active) (GMP)

In StockGMP
Code CSB-AP005921HU
Product Type Growth Factor
Size $411Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P05019
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0.
Alias Mechano growth factor,MGF,Somatomedin-C,GF-I
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg.
Purity > 98 % by SDS-PAGE and HPLC analyses.
Endotoxin Less than 0.01 EU/μg of rHuIGF-1 GMP as determined by LAL method.
Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Research Area Cancer
Source E.Coli
Gene Names IGF1
Expression Region 49-118aa
Tag Info Tag-Free
Mol. Weight 7.6 kDa
Protein Description Partial
PubMed ID 6358902; 3002851; 2935423; 2937782; 3455760; 2082190; 2018498; 1372070; 8495408; 16541075; 15489334; 6382022; 632300; 3242681; 19578119; 21076856; 22351760; 23243309; 23696648; 24132240; 6189745; 2036417; 1319992; 8857020; 10391209; 24389050
Still Have Questions? Leave a Message or Start an on-line Chat
Function The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation
Involvement in disease Insulin-like growth factor I deficiency (IGF1 deficiency)
Subcellular Location Secreted
Protein Families Insulin family
Database Links

HGNC: 5464

OMIM: 147440

KEGG: hsa:3479

STRING: 9606.ENSP00000302665

UniGene: Hs.160562

Pathway HIF-1 signaling pathway
MAPK signaling pathway
mTOR signaling pathway
p53 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Ras signaling pathway
Signaling pathways regulating pluripotency of stem cells
AMPK signaling
FoxO signaling pathway
Rap1 signaling pathway

Related Products

IGF1 Antibodies

IGF1 Antibodies for Human

IGF1 Antibodies for Homo sapiens (Human)

IGF1 ELISA Kit

IGF1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.