Recombinant Human Vascular endothelial growth factor A (VEGFA)

In Stock
Code CSB-EP025833HU
Abbreviation Recombinant Human VEGFA protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
VEGF-A;Vascular permeability factor;VPF
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-232aa
Target Protein Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.8 kDa
Protein Length
Full Length of Mature Protein of Isoform 1
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.
Gene References into Functions
  1. These results not only call into question the use of VEGFA alone in bone regeneration, but also highlight the importance in BTE of appropriately formulated combined delivery of VEGFA and BMP2. PMID: 29386057
  2. VEGF and IL-8 play a prominent role in the pathogenesis of early forms of rosacea and the hemostasis system. PMID: 29578433
  3. The Novel Short Isoform of Securin Stimulates the Expression of Cyclin D3 and Angiogenesis Factors VEGFA and FGF2, but Does Not Affect the Expression of MYC Transcription Factor PMID: 29989583
  4. these results show peripheral blood levels of VEGF are significantly increased in colorectal patients PMID: 29924680
  5. Study found that VEGF-A expression in the epidermis associated to the mechanism of facial reddened skin. PMID: 28677138
  6. Quantitative analysis of VEGF-121 isoform in the plasma of patients with recurrent glioblastoma could be a promising predictor of response to anti-angiogenetic treatment. PMID: 29747600
  7. Study evaluated for the first time the plasma levels and the diagnostic usefulness of VEGF, MMP-9, and TIMP-1 in cervical cancer (CC), not only independently but especially in combination with established cervical tumor markers. All tested parameters showed statistical significance when compared their concentrations in patients with CC to healthy women. PMID: 30037277
  8. Results showed that VEGF expression level was upregulated in gallbladder cancer (GBC) tissues and cell lines under a hypoxic condition. PMID: 30272364
  9. these results indicate that sFlt-1 up-regulation by VEGF may be mediated by the VEGF/Flt-1 and/or VEGF/KDR signaling pathways. PMID: 29497919
  10. lncRNA TDRG1 may promote endometrial carcinoma cell proliferation and invasion by positively targeting VEGF-A and modulating relative genes. PMID: 29920344
  11. The data of this study indicated that the L-VEGF144 protein is not only a novel nucleolus protein but is likely to act as a mitogen to induce the proliferation of cancer cells. PMID: 29909500
  12. Study shows that vascular endothelial growth factor A stimulates STAT3 activity via nitrosylation of myocardin to regulate the expression of vascular smooth muscle cell differentiation markers. PMID: 28572685
  13. There is no association between the studied VEGF-A single nucleotide variations and the responses to intravitreal ranibizumab therapy in diabetic macular edema. However, the VEGF-A rs833069 gene polymorphism has a clear association with the severity of diabetic retinopathy. PMID: 29030794
  14. None of the investigated VEGF-A gene polymorphisms was found to be an independent prognostic marker for infantile hemangioma. However, there is evidence that individuals carrying at least one G allele of +405 G/C VEGF-A polymorphism have significantly lower risk of IH. PMID: 29984822
  15. This study showed that CIC haplotype of VEGF gene may be important risk factor for urothelial bladder cancer development in Tunisia. PMID: 29959793
  16. FABP5 promotes tumor angiogenesis via activation of the IL6/STAT3/VEGFA signaling pathway in hepatocellular carcinoma. PMID: 29957468
  17. This study did not identify a different VEGF 936CT genotype profile for patients with CHM who undergo SR versus those who progress to gestational trophoblastic neoplasia. However, the, results do suggest that this polymor- phism may affect susceptibility to complete hydatidiform-mole. Larger groups may improve the results of assessments of the predictive parameters of gestational trophoblastic neoplasia. PMID: 30383950
  18. there may be an association between rs6993770 polymorphism of VEGF and Metabolic Syndrome PMID: 29891039
  19. The data supports the assumption that C9 gene expression may stimulate the expression of inflammatory (NLRP3) and angiogenic growth factors (VEGF) in retinal pigment epithelial cells. PMID: 30090015
  20. DEC2 could upregulate retinal VEGF gene expression through modulation of HIF1alpha levels under hypoxic conditions. PMID: 30250985
  21. High expression of VEGF is associated with Oral Invasive Carcinomas. PMID: 30049191
  22. High VEGF expression is associated with angiogenesis of esophageal squamous cell carcinoma. PMID: 30015941
  23. VEGF-A was over-expressed in hypoxic glioblastoma-derived exosomes, which enhance the permeability of a blood-brain barrier in vitro model by interrupting the expression of claudin-5 and occludin. PMID: 29787762
  24. Single CpG methylation appears to enhance VEGF G4 thermostability in a manner dependent on both the CpG methylation site and cation type PMID: 29940278
  25. shear stress was able to induce arterial endothelial differentiation of stem cells from human exfoliated deciduous teeth, and VEGF-DLL4/NotchEphrinB2 signaling was involved in this process. PMID: 30015843
  26. Data indicate that CD147 promotes breast cancer cell proliferation, metastasis, and invasion by modulating matrix metalloproteinase 9 (MMP-9) and vascular endothelial growth factor (VEGF) expression. PMID: 29901696
  27. Our data demonstrated that the expression of VEGF was significantly related to the tumor incidence, metastasis and prognosis of patients with gastric cancer, which provides new leads to the diagnosis of gastric cancer. PMID: 29914006
  28. High VEGFA expression is associated with increased lymphangiogenesis and lymph node metastasis in prostate adenocarcinoma. PMID: 29544697
  29. VEGF/PKD-1 signaling axis increases angiogenic and arteriogenic gene expression. These studies suggest that the axis may regulate arteriolar differentiation through changing microvascular endothelial cells gene expression. PMID: 29380239
  30. widely stained in sclerosing stromal tumours of the ovary PMID: 29433373
  31. Study shows how vascular endothelial growth factor regulates protein kinase CbetaII (PKCbeta) promoter function in chronic lymphocytic leukaemia cells, stimulating PKCbeta gene transcription via increased association of SP1 and decreased association of STAT3. PMID: 28233872
  32. Our study suggests that VEGF kinetics is a prognostic factor for locally advanced esophageal squamous cell carcinoma patients receiving curative concurrent chemoradiotherapy. For these patients, lower post-treatment VEGF levels and decreasing levels of VEGF during CCRT are significantly associated with better clinical outcomes. PMID: 30126380
  33. These results suggest that DMBT can inhibit CNV by down-regulation of VEGF in retina through Akt/NF-kappaB/HIF-1alpha and ERK/Nrf2/HO-1/HIF-1alpha pathway. DMBT might be a promising lead molecule for anti-CNV and serve as a therapeutic agent to inhibit CNV. PMID: 29446046
  34. the expression of MMIF, HIF-1alpha, and VEGF in the serum and endometrial tissues may be used to assess the stage of endometriosis and the severity of dysmenorrhea. PMID: 30074218
  35. H3K27me3 and VEGF expression are both significantly associated with overall survival of synovial sarcoma, and H3K27me3 is a significant independent prognostic indicator in patients with synovial sarcoma PMID: 29803658
  36. Study showed evidence that the VEGF rs699947 polymorphism was obviously associated with an increased risk of bladder cancer and renal cell carcinoma, particularly in Asian population, while no significant association was observed in overall urologic neoplasms. [review] PMID: 30195633
  37. Low VEGFA expression is associated with Breast Cancer. PMID: 28744693
  38. these findings indicated that miR655 may inhibit epithelial ovarian cancer (EOC)cell proliferation and invasion by repressing VEGF. Thus, the miR655/VEGF pathway could serve as a novel therapeutic target for patients with EOC. PMID: 29845206
  39. The VEGF protein expression in gastric cancer tissues is positively correlated with TNM staging and lymph node metastasis in patients. The preoperative prediction results of MRI are well consistent with postoperative pathological results, and MRI features are correlated with lymph node metastasis in patients, which has an important guiding significance for the diagnosis and treatment of gastric cancer. PMID: 30010108
  40. ADM was an upstream molecule of HIF-1alpha/VEGF and it promoted angiogenesis through upregulating HIF-1alpha/VEGF in epithelial ovarian cancer. PMID: 28091613
  41. The expression of VEGF was negatively correlated with miR1. PMID: 29845255
  42. EDF1 is required for VEGF-induced activation of the transcriptional activity of PPARgamma in HUVEC cells. PMID: 29933613
  43. Studied vascular endothelial growth factor A (VEGFA) gene +936T/C single nucleotide polymorphism; found it has no significant correlation with biliary atresia in the Southern Chinese Han population. PMID: 29251369
  44. miR125 targeted and inhibited the expression of VEGF through target sites located in the 3' untranslated region of VEGF mRNA. PMID: 29693153
  45. higher levels of IL-6 and VEGF-A were significantly associated with shorter progression free survival in epithelial ovarian cancer PMID: 29572186
  46. results suggest that PEDF act as a multipotent factor in the skin and the imbalance of PEDF and VEGF may be responsible for the transformation from normal skin to psoriasis. PMID: 29579411
  47. RTPCR analysis revealed that the expression levels of COX2 and VEGF were downregulated following morusin treatment... morusin significantly inhibited the proliferation of the lung cancer cell line A549, and may have affected the invasion and migration of the cells by downregulating the expression of tumor angiogenesisrelated genes. PMID: 29749480
  48. These results suggest that VM formation is increased by EBVLMP1 via VEGF/VEGFR1 signaling and provide additional information to clarify the role of EBVLMP1 in nasopharyngeal carcinoma (NPC)pathophysiology PMID: 29749553
  49. Data suggest that expression of mRNA for ghrelin and VEGFA are up-regulated in endometrium of women with recurrent miscarriage; thus, ghrelin and VEGFA may play roles in pathogenesis of recurrent miscarriage. These case-control studies were conducted with endometrial tissue obtained during secretory phase of menstrual cycle. (VEGFA = vascular endothelial growth factor A) PMID: 29221937
  50. AEG-1 was found to be significantly associated with hypoxia in ovarian cancer by regulating the HIF-1alpha/NF-kappaB/VEGF pathway. PMID: 29770329

Show More

Hide All

Involvement in disease
Microvascular complications of diabetes 1 (MVCD1)
Subcellular Location
Secreted. Note=VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a significant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.
Database Links

HGNC: 12680

OMIM: 192240

KEGG: hsa:7422

STRING: 9606.ENSP00000361125

UniGene: Hs.73793

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*