Recombinant Human Adenylate kinase isoenzyme 1 (AK1)

Code CSB-EP001508HU
Abbreviation Recombinant Human AK1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
AK1
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Adenylate kinase 1; Adenylate kinase isoenzyme 1; Adenylate kinase soluble; AK 1; Ak1; ATP AMP transphosphorylase; ATP-AMP transphosphorylase 1; KAD1; KAD1_HUMAN; Myokinase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-194aa
Target Protein Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Gene References into Functions
  1. Studies indicate that the preferred substrate and phosphate donor of all adenylate kinases are AMP and ATP respectively. PMID: 24495878
  2. Dysregulation of AMPK is both a pathogenic factor for these disorders in humans and a target for their prevention and therapy. [Review] PMID: 23863634
  3. Ak(1)2-1 phenotype is more frequent in males conceived in the summer-autumn period than in those conceived in winter-spring, and this association depends on maternal Ak(1) phenotype. PMID: 23146316
  4. identified hitherto unrecognized soluble forms of AK1 and NTPDase1/CD39 that contribute in the active cycling between the principal platelet-recruiting agent ADP and other circulating nucleotides PMID: 22637533
  5. Data indicate that the neuronal adenylate kinase-1 (AK1) is induced by Abeta(42) to increase abnormal tau phosphorylation via AMPK-GSK3beta and contributes to tau-mediated neurodegeneration. PMID: 22419736
  6. AK1 phenotypic activity is associated with birth weight and placental weight; these associations are greater in infants born at gestational age greater than 38 weeks. PMID: 21831515
  7. Our findings suggest a reduced reproductive efficiency of women carrying the Ak(1)2-1 phenotype: this could have practical importance in predicting the probability of reproductive success in couples with RSA PMID: 22287021
  8. The adipokine zinc-alpha2-glycoprotein activates AMP kinase in human primary skeletal muscle cells. PMID: 21457004
  9. how mutations found in 2 patients may affect enzyme structure and function; a compound heterozygote for 2 different missense mutations 118G>A(Gly40Arg) and 190G>A(Gly64Arg); a homozygote for either aspartic acid (Asp) 140 or 141 PMID: 12649162
  10. analysis of vascular endothelial ectoadenylate kinase and plasma membrane ATP synthase PMID: 16714292
  11. The alpha-borano or alpha-H on PMEA and PMPA were detrimental to the activity of recombinant human AMP kinases 1 PMID: 18404568
  12. The data suggest that zygotes carrying AK1*2 allele are relatively protected from the damaging effects of smoking PMID: 18850517

Show More

Hide All

Involvement in disease
Hemolytic anemia due to adenylate kinase deficiency (HAAKD)
Subcellular Location
Cytoplasm.
Protein Families
Adenylate kinase family, AK1 subfamily
Database Links

HGNC: 361

OMIM: 103000

KEGG: hsa:203

STRING: 9606.ENSP00000362249

UniGene: Hs.175473

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*