Recombinant Human Scaffold protein ILK (ILK), partial

Code CSB-EP619764HU1
Abbreviation Recombinant Human ILK protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
59 kDa serine/threonine protein kinase; 59 kDa serine/threonine-protein kinase; DKFZp686F1765 ; Epididymis secretory protein Li 28; HEL S 28; ILK 1; ILK 2; ILK; ILK-1; ILK-2; ILK_HUMAN; ILK1; ILK2; Integrin linked kinase 2; Integrin linked Kinase; Integrin linked protein kinase; Integrin-linked protein kinase; p59; p59ILK
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-228aa
Target Protein Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Regulates cell motility by forming a complex with PARVB. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.
Gene References into Functions
  1. Using molecular modeling and molecular dynamics simulations, we show that Asp344, Asp352, and Thr356 in kindlin-2 and Arg243 and Arg334 in ILK kinase domain (KD) are important in kindlin-2/ILK complex formation. Mutations that disrupt these interactions abrogate kindlin-2 and ILK colocalization in HeLa cells. PMID: 29237230
  2. High ILK expression is associated with Neuroblastoma. PMID: 29695398
  3. We further performed molecular dynamics simulation for 100ns to see the effect of urea on structural stability of kinase domain of ILK at atomic level. Structural changes with increasing concentrations of urea were analysed, and we observed a significant increase in the root mean square deviation, root mean square fluctuations, solvent accessible surface area and radius of gyration PMID: 29309873
  4. ILK overexpression in human CRC associates with EMT and CSC traits, contributing to tumor progression and chemoresistance. PMID: 29496692
  5. Dermal fibroblast-to-myofibroblast transition sustained by alphavss3 integrin-ILK-Snail1/Slug signaling is a common feature for hypermobile Ehlers-Danlos syndrome and hypermobility spectrum disorders. PMID: 29309923
  6. These results indicated that ILK promoted cell proliferation and growth in breast cancer cells through activation of the PI3K/Akt pathway. PMID: 28791358
  7. ILK-induced epithelial-mesenchymal transition is a novel mechanism in the pathogenesis of adenomyosis PMID: 29409901
  8. Herein, we propose a new ILK-MMP9-MRTF axis that appears to be critical for endothelial-mesenchymal transition differentiation of endothelial to cancer-associated fibroblasts -like cells. Thus, it might be an attractive target for cancer treatment PMID: 28893556
  9. The current data support MT1-MMP as an additional ILK substrate and show that modulation of ILK expression and activity inhibit MT1-MMP-related pro-metastatic behaviors of ovarian cancer cells. PMID: 26959113
  10. Results show that ILK is overexpressed in metastasis of bladder cancer and the up-regulation of ILK could increase cell proliferation, change cell morphology and regulate cell cycle promoting epithelial-mesenchymal transition. PMID: 27576342
  11. This study is the first to identify EMILIN-1 and ILK as prospective markers of islet regenerative function in human mesenchymal stem cells. PMID: 27090767
  12. ILK aids trophoblast syncytialization via downregulation of CDH1, perhaps through an ILK-PARP1-SNAI1 pathway PMID: 28339614
  13. We conclude that ILK is critical for maintaining the collecting duct epithelium and renal function and is a key intermediate for periostin activation of signaling pathways involved in cyst growth and fibrosis in PKD. PMID: 28522687
  14. Emodin inhibits the migration and invasion abilities of human endometrial stromal cells by by facilitating the mesenchymal-epithelial transition through targeting integrin-linked kinase. PMID: 27130230
  15. Data indicate a regulatory role for tetraspanin 8 (Tspan8) in melanoma progression by modulating cell-matrix interactions through beta1 integrin - integrin-linked kinase (ILK) axis and establish Tspan8 as a negative regulator of ILK activity. PMID: 28188308
  16. Our results define ILK as a key mechanotransducer in modulating breast cancer stem-like cells development in response to tissue mechanics and oxygen tension. PMID: 27503933
  17. Overexpression of ILK therefore promoted the proliferation of SHG44 human glioma cells, reduced apoptosis and reduced sensitivity to TMZ via decreasing the activity of caspase3. PMID: 28138714
  18. iNOS-derived NO plays a crucial role during atherosclerosis by regulating the endocytic-lysosomal degradation of ILK in endothelial cells. PMID: 28546219
  19. Using in vitro studies, we demonstrated that ILK and PI3K/AKT inhibitors suppressed the contraction of fibroblast-populated collagen lattices, inhibited fibroblast migration, and interrupted the effect of TGF-beta1 on promoting alpha smooth muscle actin (alpha-SMA) expression in fibroblasts. PMID: 27111285
  20. During human endometrial decidualization, ILK is essential for morphologic transformation of endometrial stromal cells through organization of the actin cytoskeleton. PMID: 28069177
  21. These data suggest a novel link between Tiam1 and RhoG/ILK /ELMO2 pathway as upstream effectors of the Rac1-mediated phagocytic process in trabecular meshwork cells. PMID: 27539661
  22. silencing of ILK attenuates the abnormal proliferation and migration of human Tenon's capsule fibroblasts induced by TGF-beta2. PMID: 27315599
  23. findings describe a TNFalpha-NF-kappaB-mediated mechanism by which ILK expression is induced in the lymph node microenvironment and propose that ILK promotes leukemogenesis by enabling CLL cells to cope with centrosomal defects acquired during malignant transformation PMID: 26837762
  24. High expression of ILK is associated with bladder cancer. PMID: 27683053
  25. ILK overexpression improved the proliferation, metastasis, and invasion ability of colorectal tumor cells, and this effect may be mediated by the NF-kappaB/rel/A signaling pathway. PMID: 27099440
  26. These findings suggest that emodin inhibited the EMT of EOC cells via ILK/GSK-3beta/Slug signaling pathway PMID: 28097141
  27. periostin enhanced invasion and migration abilities of EECs and facilitated the epithelial-mesenchymal transition of endometrial epithelial cell through ILK-Akt signaling pathway PMID: 27034956
  28. High ILK expression is associated with pancreatic ductal adenocarcinomas. PMID: 26887611
  29. Twist-ITGB1-FAK/ILK pathway and their downstream signaling network dictate the Twist-induced EMT process in human mammary epithelial cells and breast cancer cells PMID: 26693891
  30. Results indicated that ILK is imperative in the development and progression of oral squamous cell carcinoma. PMID: 26531674
  31. Periostin enhanced ensometrial stromal cell migration, invasion, and adhesion due to the ILK1/Akt signal pathway. PMID: 25759370
  32. high extracellular concentration of phosphate induced senescence in cultured smooth muscle through the activation of IGF-1 receptor and ILK overexpression PMID: 26467393
  33. our data suggest an essential role of PINCH1, ILK and ILKAP for the radioresistance of p53-wildtype glioblastoma multiforme cells PMID: 26460618
  34. ILK inhibition and knockdown effects senescence in an Rb-dependent manner. PMID: 26176204
  35. ILK may have an important role in the progression of NSCLC, possibly through up-regulation of Snail and MRP1. PMID: 25964055
  36. integrin linked kinase may play a role in cell proliferation, and cell migration in aggressive thyroid cancers. PMID: 26549818
  37. knockdown of ILK inhibits glioma cell migration, invasion and proliferation through upregulation of E-cadherin and downregulation of cyclin D1. Our results suggest that ILK may serve as a promising therapeutic target for glioma. PMID: 25998224
  38. Overexpression of CD29 decreased E-cadherin, but increased fibronectin, vimentin, ILK activity. PMID: 25805567
  39. Overexpression of ILK is associated with arteriosclerosis. PMID: 26210487
  40. our study shows that ILK regulates the EMT in RCC cells, and targeting ILK suppresses invasion and metastasis through inhibition of the EMT in RCC. PMID: 25657336
  41. PARVA promotes metastasis by modulating ILK signalling pathway in lung adenocarcinoma PMID: 25738875
  42. RNA silencing of ILK increases the sensitivity of the A549 lung cancer cell line to cisplatin and promotes its apoptosis. PMID: 25760437
  43. An increase in integrin-linked kinase non-canonically confers NF-kappaB-mediated growth advantages to gastric cancer cells by activating ERK1/2 PMID: 25398317
  44. ILK activity changes may act as a mechanism in response to different stimuli such as H2O2 in the induced TGF-beta1 up-regulation in pathological or even physiological conditions. PMID: 23624332
  45. ILK mediates cardiomyocyte force transduction through regulation of SERCA-2a and phosphorylation of phospholamban. PMID: 25208486
  46. critical function for ILK in mitotic cytoskeletal organization PMID: 24911651
  47. Thymosin beta4 induces invasion and migration of human colorectal cancer cells through the ILK/AKT/beta-catenin signaling pathway. PMID: 25218472
  48. A major ILK binding site in the kindlin-2 FERM domain for regulating cell adhesion has been mapped. PMID: 25160619
  49. Data demonstrate that p34SEI-1 induces the activation of either AKT or ILK signaling on HER2/neu expression status. PMID: 24789658
  50. A pivotal role of ILK in epithelial-mesenchymal transition and metastasis. PMID: 24360977

Show More

Hide All

Subcellular Location
Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, lamellipodium. Cytoplasm, myofibril, sarcomere.
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family
Tissue Specificity
Highly expressed in heart followed by skeletal muscle, pancreas and kidney. Weakly expressed in placenta, lung and liver.
Database Links

HGNC: 6040

OMIM: 602366

KEGG: hsa:3611

STRING: 9606.ENSP00000299421

UniGene: Hs.706355

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*