Recombinant Human Complement receptor type 1(CR1),partial

Code CSB-EP005932HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P17927
Relevance Mediates cellular binding of particles and immune complexes that have activated complement.(Microbial infection) Acts as a receptor for Epstein-Barr virus.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005932HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CR1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005932HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CR1.
Storage Buffer Tris-based buffer,50% glycerol
Alias C3b/C4b receptor CD_antigen: CD35
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
Source E.coli
Gene Names CR1
Expression Region 41-234aa
Tag Info N-terminal GST-tagged
Mol. Weight 48.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates cellular binding of particles and immune complexes that have activated complement.; FUNCTION
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Receptors of complement activation (RCA) family
Tissue Specificity Present on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells.
Database Links

HGNC: 2334

OMIM: 120620

KEGG: hsa:1378

STRING: 9606.ENSP00000356016

UniGene: Hs.334019

Pathway Complement and coagulation cascades
Hematopoietic cell lineage

Related Products

CR1 Antibodies

CR1 Antibodies for Human

CR1 Antibodies for Homo sapiens (Human)

CR1 Proteins

CR1 Proteins for Homo sapiens (Human)

CR1 ELISA Kit

CR1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.