Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial

In Stock
Code CSB-EP357830LKW
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357830LKW could indicate that this peptide derived from E.coli-expressed Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) GPC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357830LKW could indicate that this peptide derived from E.coli-expressed Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) GPC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
GPC
Uniprot No.
Alternative Names
GPC; GP-C; Segment; S; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Species
Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)
Source
E.coli
Expression Region
266-498aa
Target Protein Sequence
GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
42.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Discover our Recombinant Lymphocytic choriomeningitis virus (strain Armstrong) GPC, meticulously designed for your research in microbiology, specifically in the study of viral glycoproteins. This partial Pre-glycoprotein polyprotein GP complex (Pre-GP-C) derived from the Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) spans the 266-498aa expression region, ensuring a high-quality product for your experiments.

Produced in an E.coli expression system and featuring an N-terminal 6xHis-SUMO tag, our GPC protein enables straightforward purification and detection processes. With a purity greater than 90% as determined by SDS-PAGE, this protein is available in both liquid and lyophilized powder forms, giving you flexibility to meet your specific research requirements. Trust our precision-engineered Lymphocytic choriomeningitis virus GPC to deliver reliable, consistent results for your viral glycoprotein studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.; Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.; interacts with the host receptor. Mediates virus attachment to host receptor alpha-dystroglycan DAG1. This attachment induces virion internalization predominantly through clathrin- and caveolin-independent endocytosis.
Gene References into Functions
  1. The viral glycoprotein precursor (GPC)was responsible for the induction of ATF6 regulated branch of the host cell's unfolded protein response. PMID: 21106748
  2. N-linked glycan mutations at positions 87 and 97 on GP1 resulted in reduction of expression and absence of cleavage and were necessary for downstream functions, as confirmed by the loss of GP-mediated fusion activity with T87A and S97A mutants. PMID: 21056893
  3. the LCMV GP is a trimer and must be considered a member of the class I viral fusion protein family PMID: 16731928
  4. The stable signal peptide of the lymphocytic choriomeningitis virus surface glycoprotein precursor is involved in the glycoprotein (GP) precursor expression, processing, cell surface localization, particle formation and GP-mediated fusion. PMID: 17376927
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.
Protein Families
Arenaviridae GPC protein family
Database Links

KEGG: vg:956591

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*