Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex(GPC),partial

In Stock
Code CSB-EP357830LKW
Product Type Recombinant Protein
Size US$2466
Uniprot No. P09991
Relevance Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357830LKW could indicate that this peptide derived from E.coli-expressed Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) GPC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP357830LKW could indicate that this peptide derived from E.coli-expressed Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) GPC.
Storage Buffer Tris-based buffer,50% glycerol
Alias Stable signal peptide Short name: SSP Glycoprotein G1 Short name: GP1 Glycoprotein G2 Short name: GP2
Species Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR
Source E.coli
Gene Names GPC
Expression Region 266-498aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 42.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Stable signal peptide is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.
Subcellular Location Stable signal peptide: Virion membrane, Multi-pass membrane protein, Host cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Glycoprotein G1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, SUBCELLULAR LOCATION: Glycoprotein G2: Virion membrane, Single-pass membrane protein, Host cell membrane, Single-pass membrane protein
Protein Families Arenaviridae GPC protein family
Database Links

KEGG: vg:956591

Related Products

GPC Antibodies

GPC Antibodies for Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.