Recombinant Sheep Interferon gamma (IFNG)

In Stock
Code CSB-EP011050SH
Abbreviation Recombinant Sheep IFNG protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
IFNG; Interferon gamma; IFN-gamma
Species
Ovis aries (Sheep)
Source
E.coli
Expression Region
24-166a
Target Protein Sequence
QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Sheep Interferon gamma (IFNG) is produced through an E. coli expression system, which appears to provide reliable production of the full-length mature protein spanning amino acids 24 to 166. The protein carries an N-terminal 6xHis-tag that helps with purification and detection processes. This product shows a purity level greater than 90% when verified through SDS-PAGE analysis, suggesting it may be suitable for research applications where high purity matters.

Interferon gamma (IFNG) represents a key cytokine within the immune system. Its primary role involves modulating immune responses, though its effects can be quite complex. The protein activates macrophages and enhances antigen presentation - functions that likely contribute to pathogen defense mechanisms. IFNG also participates in various signaling pathways that regulate immune processes, which is why immunology researchers find it such an interesting subject to study.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The sheep IFNG is a cytokine that requires correct folding, including specific disulfide bond formation, for bioactivity (e.g., receptor binding and immune cell activation). E. coli, as a prokaryotic expression system, may not efficiently form disulfide bonds or replicate eukaryotic folding environments, potentially leading to misfolding. The His tag could sterically hinder proper folding or bioactivity. While high purity reduces impurities, it does not guarantee native conformation. Without experimental validation (e.g., circular dichroism for secondary structure or bioactivity assays), the protein may be misfolded and inactive. Therefore, correct folding and bioactivity cannot be assumed and must be verified before functional applications.

1. In Vitro Immunological Assays for Sheep-Specific Research

If the recombinant IFNG is verified to be correctly folded and recognized by specific antibodies (e.g., through Western blot or ELISA validation), it could be used as a standard or positive control in immunoassays. However, if misfolded, it may not bind antibodies effectively, leading to inaccurate quantification. Validation against native IFNG from sheep sources is essential for reliable results.

2. Antibody Development and Characterization

This recombinant IFNG can be used as an immunogen for antibody production, as antibodies often recognize linear epitopes even in misfolded proteins. The His tag facilitates purification and immobilization for screening. However, antibodies generated may not bind native IFNG in physiological contexts due to conformational differences. Antibody specificity should be validated against eukaryotic-expressed or native IFNG for applications like immunofluorescence or flow cytometry.

3. Protein-Protein Interaction Studies

If the recombinant IFNG is correctly folded, it could be used in pull-down assays to identify binding partners (e.g., IFNGR receptors). The His tag allows immobilization. However, if misfolded, interaction results may be unreliable due to altered binding sites or non-specific tag-mediated binding. Any findings must be confirmed with bioactive IFNG from eukaryotic systems.

4. Comparative Protein Structure and Function Analysis

The protein is suitable for basic biophysical characterization (e.g., circular dichroism to assess secondary structure, dynamic light scattering to monitor aggregation). However, bioactivity is required for functional comparisons across species. If misfolded, structural data may not reflect native function. Validation of activity is needed for meaningful evolutionary insights.

5. Cell Culture Supplementation for Ovine Cell Lines

This application requires bioactive IFNG to stimulate immune responses. If the protein is verified to be active (e.g., through cell-based assays like STAT1 phosphorylation), it could be used in cell culture. However, if misfolded, it will fail to induce effects, leading to false negatives. Activity must be confirmed before use.

Final Recommendation & Action Plan

Before using this recombinant sheep IFNG for any functional application, prioritize experimental validation of its folding and bioactivity. Start with biophysical assays (e.g., circular dichroism to check for expected α-helical content) and functional tests (e.g., ELISA with anti-IFNG antibodies to confirm antigenicity, or cell-based assays using ovine cells to measure STAT1 activation or MHC class II induction). If bioactivity is confirmed, proceed with intended studies; otherwise, limit use to non-functional applications like antibody production, but always validate antibodies against native IFNG. For reliable results, consider expressing IFNG in a eukaryotic system (e.g., mammalian cells) to ensure proper folding and disulfide bond formation. Avoid functional assays without prior activity confirmation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Gene References into Functions
  1. gammadelta T cells traveling in the skin-draining afferent lymph are effectors that produce IFN-gamma or IL-17 and express high levels of the skin- and inflammation-seeking molecule E-selectin ligand PMID: 23838472
  2. structural and functional characterization and role in haemonchiasis resistance PMID: 21419496
  3. results suggest that intron 1 of the interferon gamma gene has an important role in resistance to nematode infection in the Texel breed PMID: 16054889
  4. Five unique polymorphic patterns were detected and sequence analysis revealed that these patterns represent five different IFNG alleles. PMID: 16820277
Subcellular Location
Secreted.
Protein Families
Type II (or gamma) interferon family
Tissue Specificity
Released primarily from activated T lymphocytes.
Database Links

KEGG: oas:443396

UniGene: Oar.457

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*