Recombinant Bovine Transforming growth factor beta-1 proprotein(TGFB1),partial

In Stock
Code CSB-EP023446BO
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names TGFB1
Uniprot No. P18341
Research Area Others
Alternative Names TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor beta-1; TGF-beta-1)]
Species Bos taurus (Bovine)
Source E.coli
Expression Region 279-390aa
Target Protein Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 16.8kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (By similarity). Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus. Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (By similarity).
Gene References into Functions
  1. TGF-beta1 stimulated lubricin secretion by superficial zone chondrocytes at all densities with twice-a-week TGF-beta treatment. It is noteworthy that the daily treatment of TGF-beta1 increased lubricin much higher compared with twice-a-week treatment. PMID: 28578597
  2. hypoxia increased the expression of platelet-derived growth factor (PDGF) and transforming growth factor-beta1 (TGF-beta1) and decreased the expression of neprilysin (NEP), which contributed to the hypoxia-induced Endothelial-to-mesenchymal transition of pulmonary artery endothelial cells. PMID: 27373199
  3. TGF-beta1 modulates the expression of syndecan-4 in cultured vascular endothelial cells in a biphasic manner. PMID: 28019669
  4. Taken together, Staphylococcus aureus induces TGF-beta1 and bFGF expression through the activation of AP-1 and NF-kappaB in bovine mammary gland fibroblasts. PMID: 26948281
  5. localized to maternal septum in the interdigitation area of cotyledonary villi and caruncle PMID: 26382756
  6. The results identify TGFB1 and ESRRA as likely transcriptional regulators of rumen epithelial development and energy metabolism, respectively, and provide targets for modulation of rumen development and function in the growing calf. PMID: 24767884
  7. the combined treatment with TGF-beta1 and BMP-7 or treatment first with TGF-beta1 followed by BMP-7 was more effective than other treatment groups in both chondrogenic differentiation and SZP secretion. PMID: 23848497
  8. Tenascin-X promotes activation of latent TGF-beta1 and subsequent epithelial to mesenchymal transition in mammary epithelial cells. PMID: 24821840
  9. a detailed computational model for TGF-beta signalling that incorporates elements of previous models together with crosstalking between Smad1/5/8 and Smad2/3 channels through a negative feedback loop dependent on Smad7. PMID: 23804438
  10. Endogenous TGF-beta1 became more bioactive following activation of the transgene protein product in chondrocytes. PMID: 24105960
  11. A novel peptide, P2K, regulating TGF-beta1 signaling had an anabolic effect on bovine intervertebral disc cells and rabbit degenerated discs. PMID: 23124260
  12. Data show that TGF-beta pathways operate during ovarian fetal development, and fibrillin 3 is highly expressed at a critical stage early in developing human and bovine fetal ovaries. PMID: 21411746
  13. Role of TGF-beta1 and TNF-alpha in IL-1beta mediated activation of proMMP-9 in pulmonary artery smooth muscle cells: involvement of an aprotinin sensitive protease. PMID: 21722622
  14. Immunohistochemistry in rectus abdominis muscle from foetuses at 180 and 260 days post-conception PMID: 12441094
  15. vascular endothelial growth factor indirectly stimulates smooth muscle cell proliferation and migration through the modulation of basic fibroblast growth factor and transforming growth factor beta(1) released by endothelial cells PMID: 12591230
  16. Data show that as antral follicles develop, transforming growth factor (TGF)-beta3 is the most abundant TGF-beta isoform and TGF-beta1 protein levels decline in large follicles. PMID: 14502602
  17. TGF-beta 1 signaling pathway controls pericyte growth state and contractile phenotype PMID: 14609524
  18. Reactive oxygen species mediate TGF-beta1-induced TIMP-3 gene expression PMID: 15203191
  19. MGP plays a role in endothelial cell function, by increasing transforming growth factor-beta1 activity and stimulating VEGF expression PMID: 15456771
  20. Exogenous TGF-beta1, IGF-I, EGF and GH inhibited fetal bovine serum-deficiency-stimulated TGF-beta1 expression in mammary epithelium. PMID: 15747730
  21. ALK5 and Smad4 have roles in TGF-beta1-induced pulmonary endothelial permeability PMID: 16004987
  22. IGF-1 protects against TGF-beta1 mediated apoptosis in mammary gland. PMID: 16077202
  23. TGF-beta1 which is expressed in airways of asthmatics may contribute to irreversible airway remodeling by enhancing airway smooth muscle proliferation PMID: 16390551
  24. The roles of TGF-beta1 and somatotropic pathways proteins in control of the switch between survival and death of bovine mammary epithelial cells are reported. PMID: 17388018
  25. role for TGFbeta signaling in the mechanism of cellular mechanotransduction that is especially significant for joint lubrication PMID: 17968924
  26. Transforming growth factor-beta1 protects against pulmonary artery endothelial cell apoptosis via ALK5. PMID: 18456797
  27. the low friction of articular cartilage can be modified by TGF-beta1 and IL-1beta treatment and that the friction coefficient depends on multiple factors, including superficial zone protein localization and surface roughness PMID: 18683879
  28. Delayed parturition in clone calving may be associated with persistence of elevated TGF-beta-1 expression in late pregnancy. PMID: 19167845
  29. Sustained restoration of circulating latent TGFB1 to levels approaching the normal physiological range does not rescue the infertility phenotype caused by TGFB1 deficiency. PMID: 19383262
  30. TGF-beta1 downregulates caveolin-1 of cultured endothelial cells, involving ALK-5 receptor subtype PMID: 19710365

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families TGF-beta family
Database Links

KEGG: bta:282089

STRING: 9913.ENSBTAP00000027261

UniGene: Bt.469

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1