Recombinant Dog Transforming growth factor beta-1 proprotein(TGFB1),partial

Code CSB-YP023446DO
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023446DO
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023446DO-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023446DO
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023446DO
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names TGFB1
Uniprot No. P54831
Alternative Names TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor beta-1; TGF-beta-1)]
Species Canis lupus familiaris (Dog) (Canis familiaris)
Expression Region 279-390
Target Protein Sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Protein Length Partial
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (By similarity). Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus. Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (By similarity).
Gene References into Functions
  1. Results suggested that CD61 (integrin-beta3) could induce canine adipose-derived mesenchymal stem cells (cADMSCs) to differentiate into primordial germ cell (PGC)-like cells by relying on the activation of transforming growth factor beta (TGF-beta) pathway. PMID: 28256590
  2. obstructive sleep apnea can accelerate the progression of pulmonary remodeling through TGF-beta/miR-185/CoLA1 signaling PMID: 27542203
  3. TGFbeta1 signaling through the canonical SMAD pathway is increased in myxomatous mitral valves, but does not apparently mediate interstitial cell apoptosis in canine MMVD. PMID: 23816827
  4. IL-6 markedly decreased the nuclear concentration of a TGF-beta signaling transducer, Smad 2/3. PMID: 23579028
  5. celastrol downregulates Snail expression, thereby inhibiting TGF-beta1-induced EMT in MDCK and A549 cells PMID: 23850675
  6. Ostectomy healing with or without platelet-rich plasma as indicated by radiography and expression of PDGF and TGF-beta expression are reported. PMID: 23111655
  7. This study tested the hypothesis that cyclic strain and TGFbeta1 interact to modify mitral valve interstitial cell phenotype in 3D culture. PMID: 22386586
  8. PAK2 negatively modulate TGF-beta signaling by attenuating the receptor-Smad interaction and thus Smad activation PMID: 22393057
  9. This study showed a lack of an effect of recombinant inteferon-gamma on transforming growth factor-beta (TGF-beta) expression in keratinocytes. PMID: 20860556
  10. Wnt-5a is involved during oncogenic H-Ras/TGF-beta-mediated epithelial-mesenchymal transition PMID: 20511395
  11. These results show basolateral domain specificity in localization of the TGFbeta receptor signaling apparatus. PMID: 20432436
  12. These findings suggest that polyunsaturated fatty acids are able to influence proliferation of peripheral blood mononuclear cells in healthy and atopic dogs but do not seem to influence cytokine transcription. PMID: 20187917
  13. Transforming growth factor-beta 1 secreted by canine transmissible venereal tumor cells suppresses lymphokine-activated killer cytotoxicity. PMID: 14734728
  14. role played by TGF-beta in mediating the cyclosporine-induced activation of ERK1/2 and the resulting increase in transepithelial electric resistance PMID: 17460148
  15. TGFbeta1 might be associated with pulmonary vein stenosis after radiofrequency ablation in chronic atrial fibrillation of dogs PMID: 17972164

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families TGF-beta family
Database Links

KEGG: cfa:403998

STRING: 9615.ENSCAFP00000007462

UniGene: Cfa.3509

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1