Recombinant Mouse Complement receptor type 2 (Cr2), partial

In Stock
Code CSB-MP005934MO2
Abbreviation Recombinant Mouse Cr2 protein, partial
MSDS
Size $440
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Cr2 was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Cr2Complement receptor type 2; Cr2; Complement C3d receptor; CD antigen CD21
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
12-145aa
Target Protein Sequence
ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Complement receptor type 2 (Cr2) is produced in a mammalian cell expression system, which appears to ensure proper folding and post-translational modifications. This partial protein spans amino acids 12 to 145 and comes with an N-terminal 6xHis and Myc tag for easier purification and detection. SDS-PAGE verification shows the protein achieves greater than 90% purity, making it suitable for various research applications.

Complement receptor type 2 (CR2) represents an important component of the immune system. It's primarily involved in regulating B cell activation and response, though its full role may be more complex than initially understood. The receptor binds complement component C3d and likely plays a part in immune complex clearance. CR2 appears critical for adaptive immunity, and studying it could provide valuable insights into how immune function and regulation actually work.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Cr2 is a transmembrane glycoprotein that requires precise folding, proper disulfide bond formation, glycosylation, and specific tertiary structure for its functional activity in complement binding and immune regulation. The mammalian cell expression system provides the eukaryotic folding environment necessary for correct disulfide bond formation and potential glycosylation. However, the partial fragment (12-145aa) represents only a small portion of the full-length protein and lacks critical domains, including the transmembrane region and cytoplasmic tail. The dual N-terminal 6xHis-Myc tag may cause steric interference with the protein's functional domains. While mammalian expression favors proper folding, the probability of correct folding with functional complement-binding activity requires experimental validation due to the truncated nature and potential tag interference.

1. Protein-Protein Interaction Studies

This application carries a significant risk without functional validation. Cr2 interactions with complement components (e.g., C3d) require precise tertiary structure and proper domain conformation. If correctly folded and active (verified through binding assays), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine ligand-receptor interactions.

2. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition. The mammalian-expressed protein provides proper folding and relevant post-translational modifications, making it an excellent immunogen for generating antibodies that recognize native Cr2 epitopes within the 12-145aa region.

3. Structural and Biochemical Characterization

These studies are essential for determining folding status. The mammalian expression system supports proper folding, making techniques like circular dichroism spectroscopy and dynamic light scattering valuable for assessing the structural properties of this Cr2 fragment.

4. Cell-Based Binding and Uptake Assays

This application carries significant limitations. While the soluble extracellular domain fragment can be used for binding studies, it lacks the transmembrane domain required for physiological receptor function and cellular uptake. Binding data may not reflect native receptor behavior, and uptake studies are fundamentally impossible without full-length receptor expression.

Final Recommendation & Action Plan

The mammalian-expressed Cr2 extracellular domain fragment has a moderate probability of correct folding due to the appropriate expression system, but its functional applications are limited by the small size (12-145aa represents only a portion of the extracellular domain) and lack of a transmembrane domain. Begin with Application 3 (Structural Characterization) to validate folding quality through techniques like CD spectroscopy and SEC. Application 2 (antibody development) can proceed immediately. Applications 1 and 4 require rigorous validation of complement-binding functionality before use. For complete Cr2 studies, use full-length protein or larger extracellular domain constructs expressed in mammalian systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Receptors of complement activation (RCA) family
Tissue Specificity
B-lymphocytes.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*