Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Cr2

Uniprot No.

P19070

Research Area

Immunology

Alternative Names

Cr2Complement receptor type 2; Cr2; Complement C3d receptor; CD antigen CD21

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

729-963aa

Target Protein Sequence

LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.0kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The first step of making this recombinant Mouse Cr2 protein is synthesizing the Cr2 gene, the synthesized gene is then cloned into an expression vector which is a cDNA plasmid that includes a promoter sequence and an antibiotic-resistant gene. It also has N-terminal 6xHis tag encoding a fusion tag for downstream protein purification or identification. The antibiotic-resistant gene enables the selection of cells carrying the plasmid in antibiotic-based media and then transfects cells with a DNA vector that contains the template and then culturing the cells so that they transcribe and translate the desired protein. The recombinant Cr2 protein is purified by ion-exchange chromatography or affinity purification. And the purity is 90%+ by SDS-PAGE.

CR2 is a protein coding gene that encodes complement receptor type 2. According to some studies, CR2 may have the following features.
CR2 binds directly to CD19 and becomes a ligand-binding subunit of a B-cell pre-existing signal transduction complex, which may be a representative of a family of membrane protein complexes. Binding of complement receptor type 2 (CR2) to the Epstein-Barr virus glycoprotein gp350 is critical for viral attachment to B lymphocytes. Regardless of the specificity of the B cell receptor, CR2 may have a role in antigen presentation by B cells. The octapeptide is part of a structural determinant critical for both viral and natural ligand binding to CR2.

Target Background

Function

Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Receptors of complement activation (RCA) family

Tissue Specificity

B-lymphocytes.

Database Links

STRING: 10090.ENSMUSP00000080938

UniGene: Mm.235387

Code	CSB-YP005934MO
Abbreviation	Recombinant Mouse Cr2 protein, partial
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Complement receptor type 2 (Cr2), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage