Recombinant Mouse Complement receptor type 2(Cr2),partial

Code CSB-YP005934MO
Product Type Recombinant Protein
Size US$2474
Uniprot No. P19070
Relevance Receptor for complement C3d. Participates in B lymphocytes activation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Complement C3d receptor CD_antigen: CD21
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW
Research Area Immunology
Source Yeast
Gene Names Cr2
Protein Names Recommended name: Complement receptor type 2 Short name= Cr2 Alternative name(s): Complement C3d receptor CD_antigen= CD21
Expression Region 729-963aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 28.0kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Receptors of complement activation (RCA) family
Tissue Specificity B-lymphocytes.
Database Links

STRING: 10090.ENSMUSP00000080938

UniGene: Mm.235387

Pathway B cell receptor signaling pathway
Complement and coagulation cascades
Hematopoietic cell lineage

Related Products

Cr2 Antibodies

Cr2 Antibodies for Mus musculus (Mouse)

Cr2 Proteins

Cr2 Proteins for Mus musculus (Mouse)

Cr2 ELISA Kit

Cr2 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.