Recombinant Mouse Complement receptor type 2 (Cr2), partial

Code CSB-YP005934MO
Abbreviation Recombinant Mouse Cr2 protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Cr2Complement receptor type 2; Cr2; Complement C3d receptor; CD antigen CD21
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
729-963aa
Target Protein Sequence
LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The first step of making this recombinant Mouse Cr2 protein is synthesizing the Cr2 gene, the synthesized gene is then cloned into an expression vector which is a cDNA plasmid that includes a promoter sequence and an antibiotic-resistant gene. It also has N-terminal 6xHis tag encoding a fusion tag for downstream protein purification or identification. The antibiotic-resistant gene enables the selection of cells carrying the plasmid in antibiotic-based media and then transfects cells with a DNA vector that contains the template and then culturing the cells so that they transcribe and translate the desired protein. The recombinant Cr2 protein is purified by ion-exchange chromatography or affinity purification. And the purity is 90%+ by SDS-PAGE.

CR2 is a protein coding gene that encodes complement receptor type 2. According to some studies, CR2 may have the following features.
CR2 binds directly to CD19 and becomes a ligand-binding subunit of a B-cell pre-existing signal transduction complex, which may be a representative of a family of membrane protein complexes. Binding of complement receptor type 2 (CR2) to the Epstein-Barr virus glycoprotein gp350 is critical for viral attachment to B lymphocytes. Regardless of the specificity of the B cell receptor, CR2 may have a role in antigen presentation by B cells. The octapeptide is part of a structural determinant critical for both viral and natural ligand binding to CR2.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Receptors of complement activation (RCA) family
Tissue Specificity
B-lymphocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*