Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC)

In Stock
Code CSB-CF322925LCP
Abbreviation Recombinant Lassa virus GPC protein, partial
MSDS
Size $878
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GPC
Uniprot No.
Research Area
Signal Transduction
Alternative Names
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Species
Lassa virus (strain GA391) (LASV)
Source
in vitro E.coli expression system
Expression Region
259-490aa
Target Protein Sequence
GTFTWTLSDSEGNETPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFNKQAIRRLKTEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSRYWYLNHTSTGKTSLPRCWLISNGSYLNETKFSDDIEQQADNMITEMLQKEYIDRQGKTPLGLVDLFVFSTSFYLISIFLHLVKIPTHRHIVGKPCPKPHRLNHMGICSCGLYKQPGVPVRWKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC) is produced using an in vitro E.coli expression system, covering the amino acid region 259-490. This partial protein is N-terminally tagged with 10xHis, which appears to make purification and detection more straightforward. The product achieves a purity level greater than 85% as determined by SDS-PAGE, ensuring reliable use in research applications. This product is intended for research use only.

The Lassa virus Pre-glycoprotein polyprotein GP complex (GPC) seems to play a crucial role in the viral life cycle. It's involved in the maturation and function of the viral envelope glycoproteins - proteins that are essential for virus entry into host cells. This makes the GPC a potentially important target for understanding viral pathogenesis and investigating therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Epitope Mapping Studies

This recombinant GPC fragment (259-490aa) may work well as an immunogen for generating monoclonal or polyclonal antibodies against Lassa virus glycoprotein complex. The N-terminal 10xHis tag allows for purification and immobilization when screening hybridoma supernatants or serum samples. Researchers might use this protein fragment to map linear epitopes within the 259-490 amino acid region of the glycoprotein complex. The high purity (>85%) suggests minimal cross-reactivity is likely during antibody characterization studies.

2. Protein-Protein Interaction Studies

The His-tagged GPC fragment can be used in pull-down assays to identify host cell proteins that interact with this specific region of the Lassa virus glycoprotein complex. The 10xHis tag makes immobilization on nickel-affinity matrices possible, potentially capturing binding partners from cell lysates. This application could help reveal molecular mechanisms of viral entry or host cell responses, though results would need careful validation. Co-immunoprecipitation experiments using anti-His antibodies might further confirm identified interactions.

3. ELISA-Based Binding Assays

The recombinant protein can be coated onto ELISA plates to develop binding assays for studying interactions with potential receptor proteins or other viral components. The His tag may help with oriented immobilization using anti-His antibodies or nickel-coated plates, which should provide more consistent protein presentation. Researchers could use this system to screen compound libraries for molecules that disrupt protein interactions or to characterize binding kinetics with known partners. The defined amino acid region (259-490) allows for structure-activity relationship studies within this specific domain.

4. Biochemical Characterization and Structural Studies

This purified GPC fragment appears suitable for biochemical analyses including mass spectrometry, circular dichroism spectroscopy, and limited proteolysis studies. The high purity level should enable accurate determination of protein stability, folding characteristics, and post-translational modifications within the 259-490 amino acid region. Researchers can perform thermal stability assays and analyze secondary structure content of this specific glycoprotein domain. The His tag provides a convenient anchor point for protein immobilization during various analytical procedures.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.; Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.; interacts with the host receptor.
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.
Protein Families
Arenaviridae GPC protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*