Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC)

In Stock
Code CSB-CF322925LCP
Abbreviation Recombinant Lassa virus GPC protein, partial
MSDS
Size $878
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GPC
Uniprot No.
Research Area
Signal Transduction
Alternative Names
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Species
Lassa virus (strain GA391) (LASV)
Source
in vitro E.coli expression system
Expression Region
259-490aa
Target Protein Sequence
GTFTWTLSDSEGNETPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFNKQAIRRLKTEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSRYWYLNHTSTGKTSLPRCWLISNGSYLNETKFSDDIEQQADNMITEMLQKEYIDRQGKTPLGLVDLFVFSTSFYLISIFLHLVKIPTHRHIVGKPCPKPHRLNHMGICSCGLYKQPGVPVRWKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC) is produced using an in vitro E.coli expression system, covering the amino acid region 259-490. This partial protein is N-terminally tagged with 10xHis, which appears to make purification and detection more straightforward. The product achieves a purity level greater than 85% as determined by SDS-PAGE, ensuring reliable use in research applications. This product is intended for research use only.

The Lassa virus Pre-glycoprotein polyprotein GP complex (GPC) seems to play a crucial role in the viral life cycle. It's involved in the maturation and function of the viral envelope glycoproteins - proteins that are essential for virus entry into host cells. This makes the GPC a potentially important target for understanding viral pathogenesis and investigating therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Lassa virus GPC is a complex viral glycoprotein that requires precise folding, extensive disulfide bond formation, proper glycosylation, and trimerization for its functional activity in viral entry. The in vitro E. coli expression system cannot provide the necessary eukaryotic folding environment, oxidative conditions for disulfide bond formation, or glycosylation machinery required for this viral glycoprotein. The partial fragment (259-490aa) represents only a portion of the full glycoprotein and lacks critical structural domains. The N-terminal 10xHis-tag may sterically interfere with proper folding. The probability of correct folding with functional activity is extremely low.

1. Antibody Development and Epitope Mapping Studies

This application is highly suitable as antibody development primarily relies on linear epitope recognition rather than functional protein folding. The fragment (259-490aa) provides specific epitopes within this region for antibody production. However, antibodies may not recognize conformational or glycosylation-dependent epitopes present in the native viral glycoprotein.

2. ELISA-Based Binding Assays

This application is suitable for developing immunoassays to detect antibodies against linear epitopes but not for functional receptor binding studies. The protein can serve as a coating antigen for antibody detection assays, but it cannot model native glycoprotein-receptor interactions due to the lack of proper glycosylation and folding.

3. Biochemical Characterization and Structural Studies

Basic biophysical characterization can be performed, but will not reflect native glycoprotein structure. Techniques can analyze the physical properties of this specific fragment, but results will describe a non-glycosylated, misfolded protein rather than the native viral glycoprotein.

Final Recommendation & Action Plan

The in vitro E. coli expression system is fundamentally unsuitable for producing a functional Lassa virus glycoprotein due to its inability to provide proper glycosylation, disulfide bond formation, and complex folding required for viral glycoproteins. This recombinant GPC fragment is primarily suitable for Application 1 (antibody development against linear epitopes) and limited aspects of Applications 2 and 3 (immunoassay development and basic characterization). Avoid protein interaction studies entirely due to the high probability of misfolding and non-specific binding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.; Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.; interacts with the host receptor.
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.
Protein Families
Arenaviridae GPC protein family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*