Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; FB22; Fusin; HM89; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; Lipopolysaccharide-associated protein 3; LAP-3; LPS-associated protein 3; NPYRL; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Species
Homo sapiens (Human)
Expression Region
303-352aa
Target Protein Sequence
PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Partial of Isoform 2
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To produce recombinant Human CXCR4 protein, a well-established recombinant DNA technology is the key. A DNA template of CXCR4 was constructed with N-terminal 10xHis-SUMO tag & C-terminal Myc tag using the technique. Once the template was made, the recombinant Human CXCR4 protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 303-352aa of the Human CXCR4. The purity of this recombinant is 90% determined by SDS-PAGE.
CXCR4 is a protein coding gene that encodes C-X-C chemokine receptor type 4 (CD_antigen: CD184). According to some studies, CXCR4 may have the following features.
The role of CXCR4 in various diseases, including cancer and WHIM syndrome. CXCR4 expression in cancer metastases appears to be due to receptor dysregulation leading to enhanced signaling. CXCR4 regulates the growth of primary and metastatic breast cancer. CXCR4 is a prognostic marker for acute myeloid leukemia. CXCR4 plays major roles in embryonic development, homeostasis and inflammation. CXCR4 plays a key role in the crosstalk between tumor cells and their respective microenvironments, suggesting that CXCR4-targeted therapeutic approaches may become clinically important in the near future. The chemokine receptor CXCR4 is essential for vascularization of the gastrointestinal tract.
