Recombinant Human Interferon gamma(IFNG),(Active),Mammalian cell

In Stock
Code CSB-AP004241HU
Product Type Interferon
Size $65Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01579
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Alias Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG
Species Homo sapiens (Human)
Biological_Activity Specific activity as determined by a viral resistance assay using VSV-WISH cells is greater than 1.5 x 10^7 IU/mg.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Research Area Immunology
Source Mammalian cell
Gene Names IFNG
Expression Region 24-166aa
Tag Info Tag-Free
Mol. Weight 16.8 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Involvement in disease Aplastic anemia (AA)
Subcellular Location Secreted
Protein Families Type II (or gamma) interferon family
Tissue Specificity Released primarily from activated T lymphocytes.
Database Links

HGNC: 5438

OMIM: 147570

KEGG: hsa:3458

STRING: 9606.ENSP00000229135

UniGene: Hs.856

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
TGF-beta signaling pathway
Necroptosis
Antigen processing and presentation
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
Osteoclast differentiation
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

IFNG Antibodies

IFNG Antibodies for Human

IFNG Antibodies for Homo sapiens (Human)

IFNG Proteins

IFNG Proteins for Homo sapiens (Human)

IFNG ELISA Kit

IFNG ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.