Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SAG

Uniprot No.

P10523

Research Area

Signal Transduction

Alternative Names

48 kDa protein; Arrestin 1; Arrestin; ARRS_HUMAN; Retinal S antigen (48 KDa protein); Retinal S-antigen; Rod photoreceptor arrestin; RP47; S antigen; S antigen retina and pineal gland (arrestin); S arrestin; S-AG; S-arrestin; SAG

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

1-405aa

Target Protein Sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

47.1kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Unlock the potential of signal transduction research with our Recombinant Human SAG protein. S-arrestin, also known as retinal S-antigen or rod photoreceptor arrestin, plays a crucial role in the regulation of phototransduction in the retina. By modulating the activity of rhodopsin, a light-sensitive G protein-coupled receptor, SAG contributes to the desensitization and adaptation of photoreceptor cells, allowing them to adjust to changing light conditions.

Our Recombinant Human SAG protein is expressed in yeast, resulting in a full-length protein (1-405aa) that maintains its native structure and function. The N-terminal 6xHis-tag allows for efficient purification and easy detection of the protein. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human SAG protein ensures reliable and consistent results for your signal transduction research. Available in both liquid and lyophilized powder forms, our Recombinant Human SAG protein is an indispensable tool for exploring the complex world of cellular signaling pathways.

Target Background

Function

Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells.

Gene References into Functions

This is the first dominant-acting mutation identified in SAG, a founder mutation possibly originating in Mexico several centuries ago. The phenotype is clearly adRP and is distinct from the previously reported phenotypes of recessive null mutations, that is, Oguchi disease and recessive RP. PMID: 28549094
Macular dysfunction can occur in Oguchi disease with the 1147delA mutation in the SAG gene. PMID: 21447990
Based on their observed affinity for arrestin-1, P-opsin and inactive P-Rh very likely affect the physiological monomer-dimer-tetramer equilibrium of arrestin-1, and should therefore be taken into account when modeling photoreceptor function. PMID: 23277586
Compound heterozygosity of a nonsense R193X mutation and a heterozygous deletion of 3,224 bp encompassing exon 2 in the SAG gene is the cause of Oguchi's disease in a Chinese family. PMID: 22419846
the arrestin 1147delA, which has been known as a frequent cause of Oguchi disease, also may be related to the pathogenesis of autosomal recessive RP. PMID: 21922265
We describe a case of Oguchi disease with unusual findings caused by a putative heterozygous mutation in the SAG gene. PMID: 21987685
maintenance of low levels of the active monomer is the biological role of arrestin-1 self-association PMID: 21288033
Rhodopsin-arrestin complexes alter the morphology of endosomal compartments and severely damage receptor-mediated endocytic functions in retinitis pigmentosa. PMID: 15232620
The existence of 2 novel mutations of the arrestin gene in 2 unrelated Japanese patients strongly supports the previous data that arrestin gene mutations are associated with Oguchi's disease PMID: 15234147
Mutation 926delA of the SAG gene is the main cause of Oguchi disease in Japanese. This mutation appears to have been inherited from a single founder. PMID: 15295660
The tetramer form of arrestin increases the arrestin-binding capacity of microtubules while readily dissociating to supply active monomer when it is needed to quench rhodopsin signaling. PMID: 17332750
ARRESTIN binds to different phosphorylated regions of the thyrotropin-releasing hormone receptor with distinct functional consequences. PMID: 18413662
S-Ag specific T cells are present in certain active Behcet's disease patients, and most of them are activated memory CD4(+) T cells. PMID: 18685727

Hide All

Involvement in disease

Night blindness, congenital stationary, Oguchi type 1 (CSNBO1); Retinitis pigmentosa 47 (RP47)

Subcellular Location

Cell projection, cilium, photoreceptor outer segment. Membrane; Peripheral membrane protein.

Protein Families

Arrestin family

Tissue Specificity

Detected in retina, in the proximal portion of the outer segment of rod photoreceptor cells (at protein level).

Database Links

HGNC: 10521

OMIM: 181031

KEGG: hsa:6295

STRING: 9606.ENSP00000386444

UniGene: Hs.32721

Code	CSB-YP020669HU
Abbreviation	Recombinant Human SAG protein
MSDS	MSDS Datasheet
Size	$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP020669HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SAG. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP020669HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SAG.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human S-arrestin (SAG)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage