Recombinant Human S-arrestin(SAG)

In Stock
Code CSB-YP020669HU
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P10523
Relevance Arrestin is one of the major proteins of the ros (retinal rod outer segments); it binds to photoactivated-phosphorylated rhodopsin, thereby apparently preventing the transducin-mediated activation of phosphodiesterase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP020669HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SAG.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP020669HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SAG.
Storage Buffer Tris-based buffer,50% glycerol
Alias 48 kDa protein Retinal S-antigen Short name: S-AG Rod photoreceptor arrestin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
Research Area Signal Transduction
Source Yeast
Gene Names SAG
Protein Names Recommended name: S-arrestin Alternative name(s): 48 kDa protein Retinal S-antigen Short name= S-AG Rod photoreceptor arrestin
Expression Region 1-405aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 47.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO (By similarity). May play a role in preventing light-dependent degeneration of retinal photoreceptor cells
Involvement in disease Night blindness, congenital stationary, Oguchi type 1 (CSNBO1); Retinitis pigmentosa 47 (RP47)
Subcellular Location Cell projection, cilium, photoreceptor outer segment, Membrane, Peripheral membrane protein
Protein Families Arrestin family
Tissue Specificity Detected in retina, in the proximal portion of the outer segment of rod photoreceptor cells (at protein level).
Database Links

HGNC: 10521

OMIM: 181031

KEGG: hsa:6295

STRING: 9606.ENSP00000386444

UniGene: Hs.32721

Related Products

SAG Antibodies

SAG Antibodies for Homo sapiens (Human)

SAG Proteins

SAG Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.