Name: Recombinant Human Signal transducer and activator of transcription 3 (STAT3), partial
Brand: CUSABIO
SKU: CSB-EP022812HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

STAT3

Uniprot No.

P40763

Research Area

Immunology

Alternative Names

1110034C02Rik; Acute Phase Response Factor; Acute-phase response factor; ADMIO; APRF; AW109958; DNA binding protein APRF; FLJ20882; HIES; MGC16063; Signal transducer and activator of transcription 3 (acute phase response factor); Signal transducer and activator of transcription 3; STAT 3; Stat3; STAT3_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

50-240aa

Target Protein Sequence

ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

38.3kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Discover the power of our premium Recombinant Human STAT3 protein, a vital tool for researchers investigating the signal transducer and activator of transcription 3, also known as the acute-phase response factor. STAT3 is a key player in numerous cellular processes, including cell growth, apoptosis, and immune response, making it an essential target for scientific exploration across various research areas.

Our Recombinant Human STAT3 protein is expressed in E.coli, yielding a partial protein (50-240aa) that maintains native structure and function. With an N-terminal 6xHis-SUMO tag, this protein enables efficient purification and detection, ensuring consistent and reliable results for your research. The purity of our Recombinant Human STAT3 protein is greater than 90%, as determined by SDS-PAGE, providing you with the quality needed for your experiments. Choose between liquid and lyophilized powder formats to best suit your research requirements.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 2 reviews

Submit a Review here

Applications : Western blot assays and Surface Plasmon Resonance (SPR) experiments

Review: Compound 4m inhibited STAT3 phosphorylation in HCT-116. The HCT-116 were serum-starved overnight, then left untreated or treated with CEL (1.0 lM) and 4m (0.5, 0.75, 1.0 lM) for 6 h, followed by stimulation by IL-6 (25 mg/mL). The cells were harvested at 30 min and analysed by Western blot assays.

By Anonymous

Applications : SPR analysis of CEL-2 to recombinant human STAT3 protein

Review: CEL-2 effectively decreased the level of p-STAT3 at site pTyr705 in a concentration-dependent manner, and the inhibitory effect of CEL-2 was stronger than CEL at 0.75 lM. However, the total level of STAT3 was not changed with CEL-2 treatment.

By Anonymous

Read more reviews >>

■ Q&A

I am interested in several of your recombinant proteins. Can you please provide some informations:
For CSB-EP022812HU (all expression systems):
a.Sequence
b.Tag type
c.Tag position
d.Sizes and formats
e.Is the protein provided soluble in solution?
f.Is the protein purified from bacterial inclusion bodies are you supplied refolded or still in urea?
g.I want to use this protein for conjugation purposes and need it supplied in an amine free buffer (so not Tris). Can you supply this protein in one of the buffers at my request: phosphate, carbonate, or borate? Would there be an extra charge?

Thanks for your inquiry. Proteins will be supplied soluble in solution.
It is not certain for the protein to be expressed in the supernatant or precipitation, but our proteins are provided with folding correctly.
If you need it supplied in an amine free buffer (so not Tris). We can do this. Please mention this requirement in your official order. We can try to provide PBS buffer, this is not extra charged.
Recombinant Human Signal transducer and activator of transcription 3(STAT3)，partial
CSB-YP022812HU >> Yeast
CSB-EP022812HU >> E.coli
CSB-BP022812HU >> Baculovirus
CSB-MP022812HU >> Mammalian cell
Expression Region: 50-240aa；Partial
Tag information:EP:N-terminal 6xHis-SUMO-tagged;YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for other expression systems: YP: N-terminal 6xHis-tagged; BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL

Recombinant Human Signal transducer and activator of transcription 3(STAT3)
CSB-YP022812HU(A4) >> Yeast
CSB-EP022812HU(A4) >> E.coli
CSB-BP022812HU(A4) >> Baculovirus
CSB-MP022812HU(A4) >> Mammalian cell
Expression Region: 1-770aa；Full length
Tag information:YP:N-termial 6xHis-tagged;EP,BP,MP: Tag type will be determined during the manufacturing process.
The expected tag for other expression systems: EP,MP,BP are N-termial 6xHis-tagged
Sequence:

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM

Target Background

Function

Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors. Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Upon activation of IL6ST/gp130 signaling by interleukin-6 (IL6), binds to the IL6-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA. Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): deacetylation and oxidation of lysine residues by LOXL3, leads to disrupt STAT3 dimerization and inhibit its transcription activity. Involved in cell cycle regulation by inducing the expression of key genes for the progression from G1 to S phase, such as CCND1. Mediates the effects of LEP on melanocortin production, body energy homeostasis and lactation. May play an apoptotic role by transctivating BIRC5 expression under LEP activation. Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity. Plays a crucial role in basal beta cell functions, such as regulation of insulin secretion.

Gene References into Functions

I157172 induced upregulation of SIRT1, and downregulation of acetyl-STAT3. PMID: 30365149
an HBV-pSTAT3-SALL4-miR-200c axis regulates PD-L1 causing T cell exhaustion PMID: 29593314
reveal that breast cancer stem cell (BCSC) in triple-negative breast cancer depend on the transcription regulator HN1L for the sustained activation of the LEPR-STAT3 pathway, which makes it a potentially important target for both prognosis and BCSC therapy. PMID: 29249663
findings illustrate the significance of CREB-KDM4B-STAT3 signaling cascade in DNA damage response, and highlight that KDM4B may potentially be a novel oncotarget for colorectal cancer radiotherapy. PMID: 29633065
TNFRSF1A is a STAT3 target gene that regulates the NF-kappaB pathway. PMID: 29621649
Downregulation of miR-340 inhibited GC cell proliferation, arrested cell cycle, and facilitated apoptosis through upregulating SOCS3 expression to suppress JAK-STAT3 signaling pathway. PMID: 29658372
we wanted to explore whether STAT3 can be related to lymph node micrometastasis of non-small cell lung cancer (NSCLC). To address this question, we evaluated the expression of MUC1 mRNA in the lymph node samples of NSCLC to determine micrometastasis. Then, we evaluated what role STAT3 overexpression plays in lymph node micrometastasis of NSCLC. PMID: 29575778
Our results showed that IL-37 plays an inhibitory role in non-small cell lung cancer progression, possibly by suppressing STAT3 activation and decreasing epithelial-to-mesenchymal transition by inhibiting IL-6 expression. IL-37 could serve as a potential novel tumor suppressor in non-small cell lung cancer PMID: 29575809
Study shows that vascular endothelial growth factor A stimulates STAT3 activity via nitrosylation of myocardin to regulate the expression of vascular smooth muscle cell differentiation markers. PMID: 28572685
The investigation demonstrated that the serum levels of FGF23 and the phosphorylation levels of JAK2, STAT1, and STAT3 were up-regulated in the ovariectomy (OVX) + NVP-BGJ398 group while were down-regulated in the OVX + Anti-FGF23 group than that in the OVX group. PMID: 28782829
Genetic or pharmacologic inactivation of SHP2 promotes accumulation of JAK2 phosphorylated at Y570, reduces JAK2/STAT3 signaling, inhibits TGFbeta-induced fibroblast activation and ameliorates dermal and pulmonary fibrosis. PMID: 30108215
Mir-204 attenuates angiogenesis in lung adenocarcinoma via JAK2-STAT3 pathway. PMID: 29281186
Study utilizing integrative analysis of transcriptomic, metabolomic, and clinical data propose a model of GOT2 transcriptional regulation, in which the cooperative phosphorylation of STAT3 and direct joint binding of STAT3 and p65/NF-kappaB to the proximal GOT2 promoter are important. PMID: 29666362
FEZF1-AS1 acts as an oncogenic lncRNA in human hepatocellular carcinoma by promoting JAK2/STAT3 signaling-mediated epithelial mesenchymal transformation. PMID: 29957463
FABP5 promotes tumor angiogenesis via activation of the IL6/STAT3/VEGFA signaling pathway in hepatocellular carcinoma. PMID: 29957468
The result of our study for the first time provides evidence that rs1053004 polymorphism is significantly associated with a decreased risk of Cardiopulmonary bypass-associated acute kidney injury in Iranian population, especially in older subjects. PMID: 29846833
Simultaneous inactivation of EAF2 and p53 can act to activate STAT3 and drive prostate tumorigenesis. PMID: 29518696
a transcription-independent mechanism for Stat3-mediated centrosome clustering that involves Stathmin, a Stat3 interactor involved in microtubule depolymerization, and the mitotic kinase PLK1, is reported. PMID: 28474672
This review discusses the upstream activators of STAT3 in skeletal muscles, with a focus on interleukin 6 (IL6) and transforming growth factor beta 1 (TGF-beta1). PMID: 30072615
High STAT3 expression is associated with lung adenocarcinoma. PMID: 30015929
JAK2 and STAT3 are activated in Idiopathic pulmonary fibrosis PMID: 29409529
The results reveal that the EGF-STAT3 signaling pathway promotes and maintains colorectal cancer (CRC)stemness. In addition, a crosstalk between STAT3 and Wnt activates the Wnt/beta-catenin signaling pathway, which is also responsible for cancer stemness. Thus, STAT3 is a putative therapeutic target for CRC treatment. PMID: 30068339
MiR-29a down-regulation is correlated with drug resistance of nasopharyngeal carcinoma cell line CNE-1 and MiR-29a up-regulation decreases Taxol resistance of nasopharyngeal carcinoma CNE-1 cells possibly via inhibiting STAT3 and Bcl-2 expression. PMID: 29914005
Kidney biopsies from patients with IgA nephropathy and diabetic nephropathy exhibited substantial activation of p53 and STAT3, decreased expression of SOCS7, and increase in profibrotic proteins and miR-199a-3p. PMID: 28240316
Low-dose radiation decreases tumor progression via the inhibition of the JAK1/STAT3 signaling axis in breast cancer cell lines and in a mouse xenograft model. PMID: 28240233
High STAT3 expression is associated with cell growth, aggressiveness, metastasis in gastric cancer. PMID: 30015981
High expression of iNOS and STAT3 in cells transfected with miR-34a mimic further validated it. PMID: 30021364
Findings outlined in the current study demonstrated that the inhibition of P16 decreased the growth and metastasis potential of BC cells by inhibiting IL-6/JAK2/STAT3 signaling. PMID: 29388151
G6PD contributes to HCC migration and invasion of hepatocellular carcinoma cells by inducing epithelial-mesenchymal transition through activation of signal transducer and activator of transcription 3 PMID: 29471502
CXCR7 silencing inhibits the migration and invasion of human tumor endothelial cells derived from hepatocellular carcinoma by suppressing STAT3. PMID: 29901083
These data show that activated p-STAT3 upregulates epithelial-to-mesenchymal transition-related proteins and promotes vasculogenic mimicry. PMID: 29333928
High STAT3 expression is associated with drug resistance in Chronic myeloid leukemia. PMID: 29936783
Case Report: breast implant-associated anaplastic large cell lymphoma with dual JAK1/STAT3 mutations. PMID: 29637270
Data indicate that signal transducer and activator of transcription 3 (STAT3) has emerged as a promising target in cancer immunotherapy [Review]. PMID: 29222039
Downregulation of the lincRNA of the NED25 gene was associated with sepsis in patients by modulating the signaling pathways downstream of miR-125b/STAT3/PCT/NO signaling pathway. PMID: 29962507
High STAT3 expression is associated with invasion and lymph node metastasis in gastric cancer. PMID: 29970682
The present study demonstrated that the downregulation of filaggrin in the epidermis by toluene is mediated by ERK1/2 and STAT3-dependent pathways. PMID: 27498358
these results indicated that STAT3-mediated downexpression of miR-579-3p caused resistance to vemurafenib. Our findings suggest novel approaches to overcome resistance to vemurafenib by combining vemurafenib with STAT3 sliencing or miR-579-3p overexpression. PMID: 30010109
Our study identified the STAT3 rs1053004 C/C as a high-risk genotype in MA (MISSED ABORTION) with lower survivin and VEGF transcription levels in the peripheral blood PMID: 30226700
The role of mitochondrial Stat3 as regulator for lymphocyte function is reviewed. PMID: 29866996
addition of colivelin, a STAT3 activator, instead of IL-6 and C2C12 conditioned medium, promoted the myogenic differentiation of adipose tissue-derived stem cells. PMID: 29882916
These results suggested that stemness induction in SKOV3 cells by macrophages co-cultured with SKOV3-derived OCSLCs involved IL-8/STAT3 signaling. PMID: 29656182
Parthenolide also induced reactive oxygen species (ROS), but the increased ROS did not seem to contribute to the inhibition of JAK/STAT3 signaling. PMID: 29921758
The phosphor STAT3 expression was associated with adverse survival in squamous cell carcinoma, but not in the oesophageal adenocarcinoma patients. PMID: 29890775
In Ishikawa human endometrial adenocarcinoma cell line MIG-6 negatively regulates the phosphorylation of STAT3 via direct protein interaction with STAT3. PMID: 28925396
IL-23 binding to its receptor promotes the migration and invasion of gastric cancer cells by inducing epithelial-to-mesenchymal transition through the STAT3 signaling pathway. PMID: 29574157
Oct4 plays a vital role in the malignant progression of HCC cells through the survivin/STAT3 signaling pathway. PMID: 29901157
our data demonstrate that hypoxia strongly potentiates the peroxide-mediated induction of hepcidin via STAT3 signaling pathway. Moreover, oxidases such as NOX4 or artificially overexpressed urate oxidase (UOX) can induce hepcidin PMID: 29459227
a novel signal circuit of Stat3/Oct-4/c-Myc was identified for regulating stemness-mediated Doxorubicin resistance in triple-negative breast cancer PMID: 29750424
Data show that knockdown of STAT transcription factors STAT3 and/or STAT5 reduces DNA methylcytosine dioxygenase Ten-eleven translocation 1 (TET1) level. PMID: 29235481

Hide All

Involvement in disease

Hyperimmunoglobulin E recurrent infection syndrome, autosomal dominant (AD-HIES); Autoimmune disease, multisystem, infantile-onset, 1 (ADMIO1)

Subcellular Location

Cytoplasm. Nucleus. Note=Shuttles between the nucleus and the cytoplasm. Translocated into the nucleus upon tyrosine phosphorylation and dimerization, in response to signaling by activated FGFR1, FGFR2, FGFR3 or FGFR4. Constitutive nuclear presence is independent of tyrosine phosphorylation. Predominantly present in the cytoplasm without stimuli. Upon leukemia inhibitory factor (LIF) stimulation, accumulates in the nucleus. The complex composed of BART and ARL2 plays an important role in the nuclear translocation and retention of STAT3. Identified in a complex with LYN and PAG1.

Protein Families

Transcription factor STAT family

Tissue Specificity

Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in naive CD4(+) T cells as well as T-helper Th17, Th1 and Th2 cells.

Database Links

HGNC: 11364

OMIM: 102582

KEGG: hsa:6774

STRING: 9606.ENSP00000264657

UniGene: Hs.463059

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP022812HU
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022812HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) STAT3. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022812HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) STAT3.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Signal transducer and activator of transcription 3 (STAT3), partial

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage