Code | CSB-EP022812HU |
Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
E.coli-expressed recombinant human signal transducer and activator of transcription 3 (STAT3) contains 191 amino acids covering the partial-length of STAT3 protein (50-240aa). And it has its N-terminus fused with a 6xHis-SUMO-tag and a total molecular weight of 38.3 kDa. The purity of this human STAT3 protein is greater than 90% measured by SDS-PAGE. Its identity was validated by the LC-MS/MS analysis. This protein is in-stock, which means there is no waiting period for protein preparation. This recombinant STAT3 protein may find uses in the specific antibody synthesis or the studies of immunology. STAT3 transduces extracellular signals from cytokines such as IL6, Il8, and IL35 and regulates the expression of numerous genes crucial for immune responses and cell differentiation. STAT3 is also regarded as an early tumor diagnostic marker and is known to promote breast cancer malignancy. JAK–STAT3 signaling is critical for cancer development in both tumor cells and the tumor microenvironment. Recent studies showed that overexpressed and constitutively activated STAT3 is involved in the proliferation, progression, metastasis, and chemoresistance of breast cancer. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | STAT3 |
Uniprot No. | P40763 |
Research Area | Immunology |
Alternative Names | 1110034C02Rik; Acute Phase Response Factor; Acute-phase response factor; ADMIO; APRF; AW109958; DNA binding protein APRF; FLJ20882; HIES; MGC16063; Signal transducer and activator of transcription 3 (acute phase response factor); Signal transducer and activator of transcription 3; STAT 3; Stat3; STAT3_HUMAN |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 50-240aa |
Target Protein Sequence | ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 38.3kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
Applications : Western blot assays and Surface Plasmon Resonance (SPR) experiments
Review: Compound 4m inhibited STAT3 phosphorylation in HCT-116. The HCT-116 were serum-starved overnight, then left untreated or treated with CEL (1.0 lM) and 4m (0.5, 0.75, 1.0 lM) for 6 h, followed by stimulation by IL-6 (25 mg/mL). The cells were harvested at 30 min and analysed by Western blot assays.
By Anonymous
I am interested in several of your recombinant proteins. Can you please provide some informations:
For CSB-EP022812HU (all expression systems):
a.Sequence
b.Tag type
c.Tag position
d.Sizes and formats
e.Is the protein provided soluble in solution?
f.Is the protein purified from bacterial inclusion bodies are you supplied refolded or still in urea?
g.I want to use this protein for conjugation purposes and need it supplied in an amine free buffer (so not Tris). Can you supply this protein in one of the buffers at my request: phosphate, carbonate, or borate? Would there be an extra charge?
ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Function |
Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors. Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Upon activation of IL6ST/gp130 signaling by interleukin-6 (IL6), binds to the IL6-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA. Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): deacetylation and oxidation of lysine residues by LOXL3, leads to disrupt STAT3 dimerization and inhibit its transcription activity. Involved in cell cycle regulation by inducing the expression of key genes for the progression from G1 to S phase, such as CCND1. Mediates the effects of LEP on melanocortin production, body energy homeostasis and lactation. May play an apoptotic role by transctivating BIRC5 expression under LEP activation. Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity. Plays a crucial role in basal beta cell functions, such as regulation of insulin secretion.
|
Gene References into Functions |
|
Involvement in disease | Hyperimmunoglobulin E recurrent infection syndrome, autosomal dominant (AD-HIES); Autoimmune disease, multisystem, infantile-onset, 1 (ADMIO1) |
Subcellular Location | Cytoplasm. Nucleus. Note=Shuttles between the nucleus and the cytoplasm. Translocated into the nucleus upon tyrosine phosphorylation and dimerization, in response to signaling by activated FGFR1, FGFR2, FGFR3 or FGFR4. Constitutive nuclear presence is independent of tyrosine phosphorylation. Predominantly present in the cytoplasm without stimuli. Upon leukemia inhibitory factor (LIF) stimulation, accumulates in the nucleus. The complex composed of BART and ARL2 plays an important role in the nuclear translocation and retention of STAT3. Identified in a complex with LYN and PAG1. |
Protein Families | Transcription factor STAT family |
Tissue Specificity | Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in naive CD4(+) T cells as well as T-helper Th17, Th1 and Th2 cells. |
Database Links |
HGNC: 11364 OMIM: 102582 KEGG: hsa:6774 STRING: 9606.ENSP00000264657 UniGene: Hs.463059 |