Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP006239HUa2 |
| Size | $419 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | CXCL1 |
| Uniprot No. | P09341 |
| Research Area | Immunology |
| Alternative Names |
C-X-C motif chemokine 1; Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity; alpha); chemokine (C-X-C motif) ligand 1; CINC-1; CXCL1; Cytokine-induced neutrophil chemoattractant 1; Fibroblast secretory protein ; Fsp; Gro 1; Gro A; Gro; GRO protein; alpha; GRO-alpha(1-73); GRO-alpha(6-73); Gro1; GRO1 oncogene (melanoma growth stimulating activity; alpha); GRO1 oncogene (melanoma growth-stimulating activity) ; Gro1 oncogene; GROa; GROA_HUMAN; Growth-regulated alpha protein; KC; KC chemokine; mouse; homolog of; melanoma growth stimulatory activity alpha ; Melanoma growth stimulatory activity; Melanoma growth stimulatory activity; alpha; MGSA alpha ; MGSA; MGSA-a; N51; NAP-3; NAP3; Neutrophil-activating protein 3; Platelet-derived growth factor-inducible protein KC; Scyb 1; Scyb1; Secretory protein N51; Small inducible cytokine subfamily B; member 1
|
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 35-107aa |
| Target Protein Sequence | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 23.9kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal 6xHis-SUMO-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
|
| Gene References into Functions |
|
| Subcellular Location | Secreted. |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Database Links |
HGNC: 4602 OMIM: 155730 KEGG: hsa:2919 STRING: 9606.ENSP00000379110 UniGene: Hs.708652 |
